Identifiers and Description

Gene Model Identifier

TTHERM_00923040

Standard Name

SAK2

Aliases

PreTt21183 | 164.m00076

Description

Snk/Plk-Akin Kinase

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF01163 ) RIO1 family
  • ( PF00069 ) protein kinase domain
  • ( PF07714 ) protein tyrosine kinase
  • ( PF05316 ) Mitochondrial ribosomal protein (VAR1)
  • ( PF03665 ) Uncharacterised protein family (UPF0172)

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.3%

TetraMine Data

TTHERM_00923040

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_13241.19.997093137033517e-262protein kinase domain-containi
ng protein (976 aa)
DictyBaseDDB_G02844899.004005705510192e-49pdkB on chromosome: 4 position
2038480 to 2041297
OxytrichaContig8002.0.g381.9998745702418095e-48Protein kinase domain
WormBaseWBGene000021891.000499495426459e-47locus:kin-1 cAMP-dependent p
rotein kinase catalytic subuni
t status:Confirmed UniProt
:P21137 protein_id:CAD45614.
1
SGDYPL203W2.000364041471746e-45TPK2 cAMP-dependent protein ki
nase catalytic subunit; promot
es vegetative growth in respon
se to nutrients via the Ras-cA
MP signaling pathway; partiall
y redundant with Tpk1p and Tpk
3p; localizes to P-bodies duri
ng stationary phase
Stentor CoeruleusSteCoe_46263.975449735908647e-31

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:16933976: Eisen JA, Coyne RS, Wu M, Wu D, Thiagarajan M, Wortman JR, Badger JH, Ren Q, Amedeo P, Jones KM, Tallon LJ, Delcher AL, Salzberg SL, Silva JC, Haas BJ, Majoros WH, Farzad M, Carlton JM, Smith RK, Garg J, Pearlman RE, Karrer KM, Sun L, Manning G, Elde NC, Turkewitz AP, Asai DJ, Wilkes DE, Wang Y, Cai H, Collins K, Stewart BA, Lee SR, Wilamowska K, Weinberg Z, Ruzzo WL, Wloga D, Gaertig J, Frankel J, Tsao CC, Gorovsky MA, Keeling PJ, Waller RF, Patron NJ, Cherry JM, Stover NA,

Sequences

>TTHERM_00923040(coding)
ATGATAACTTAAATGATTCAATAGAAAAAAGATTAAAAGCCAAAAAGTAGCTCTTAGTAA
GTTGAAGAAGAGGAAAATCATTTAATGAATAGTATTTCAACTAGTTTACATAATTTTAAG
ATTACTTTAACTCTTGGTAGAGGCGCAGGAAGTTGCGTTTTTCTAATTGAAGAATACAAA
TCTGGATCGCTTTATGCTTTAAAAACAATCACAAAATAGTCATAATATTACACTAACAAT
ATTAATAGAATCAAAAATGAATATAATCTACACTCATAACTAGACCATCCAAACATAGTA
AAAATTTTAAAAAGATTCGAAGACAATGAATATGTATATATGATGCTTGAGTATTGCCCA
GGAGGCAGTCTTTTTGATTATGTAAAAAGTAAAGGAAGGCTCAATGAAGATGAAGCAAGA
GACATTTCATATTAAATTGTATAAGGTCTTGAATACTTACACAAAAACAAAATTATTCAT
AGAGATTTAAAGCCTGGTAATATTTTGCTTACTGGGAATAACAGCGTTAAAATTTGTGAT
TTCGGGTTAGCTGTAAGAGTAACTAACTACGAATCGGAGAGAGACACATTTTGCGGAACT
CCTAATTACATAGCTCCAGAAATTTGTAGCAGGGAAAAGTATGGAATATAATCAGATTGC
TGGTCTTTTGGGTGCATTCTATACACTATTGCTACTGGTAGACCTCCTTTTGAAACAGTG
AGTATATAACAAACACTAAAAATGCTATAAAAAAAGAATAAAGTAGAGTATCCTTCTCAC
TTATCTAAATCTTTAGTTGATCTAATTGATCATATACTTGATTGGAATTAAGACACAAGA
TACAATATCAGTTAAATAAAAAGTCATCCTTTTTATAATAAATCCAAATAAAATACTCAT
GAAAATGAATATAAATTATAAAATCCTATGACTTTTGCTCCTCCTCAACCATTTTAAATG
GAATAATCTGTCAATTAAAATAATAAAAATATTTAACAAGGGCATACTAGGCAAAGATCT
AATTTTTCAATGGATTCGTCTAACAATTCTAAACATTTTTAATAAAATAAAATAATGAAT
GATAATTTATATTAAATTAACAATATAAATCGCTCCAATCAAATCTAAGAAAATAACGTT
TTACAAAATAAACAAACTAAAGAAAATAGATTTTAAAGCAAAGAATAATTATTAGTAAAT
GAAAATAAGGAAAATATCCATTCAAATATTCTAAATTCAATTAATAATTAACAAAAATTA
TTTTAGCAATAACAAAAGTTAAACCCTATACCACTTTAAAAATCTTACAGCTATAATCAG
AAGAACGAGTAAAAGCAAGATTAGATATTGCACTAAACTTTAGCTTAAGGCTTAAAGAAG
GAAGTAAGTGAATAAAGCATAGATAATAATAGAAACAAATAAATAATATAAGAAATTTAA
AATATATCATAAAATTCTTATTATAATCCATAAATATCCTAATCAAACAAATAGTAATAG
CAATAAATAGATACTATTTAGTAAAAACCATAAAGCAAAACTATATTGAATACATTCTTG
AATAAAGCCACTAAATCGAATTCTCTTCATCAATCGTCATCTACTACTCCCTCAAGCAAC
TAGCAAAATATCAATACAAATAATTTTTTTTAATCATAAAAATCTTATAAAAACCCTATA
GTATAAATTTTAAATGGATTTCCTAATGACTCAAAGATTTAATAAAATCAAGCAATTAAT
CATTAAAAAAATAAAAGTCTTGATATAAGTGGTATAATACCACCTCAACCTCCTCGTCCT
CGGGATGAATAAAAAAATCAGCTTAGTTTTAAAACTATAGATTAAGAAAATATTTAAAAA
AAGCAAATATCTATTGATTAATCTAACTAAAACGAGTTTGTAACTACTCCAAGTGGAAAT
AATAAAATGTTTTCTCAATCATCAAACAACATGATTTTTATGAAAGAGAACAACAATTCT
AAAATATAAAATGTTAAAAAGAAAATGAGTCTCCATTTTCCAACTGAATAAACAAATATT
AGCCAAGATATAATAAGCACAAACACAACATGCAGGAATAACATAACAACAACCATGACC
TTTCCTTCTCCTTCGTCTTAATAGTTTTTAGCATAAAATAATAATAATCAAATAATAATA
AATTAAAATATTTAAAGATAAAAACCCTCTAAATCAACACATAATAATGATAATAATCAC
ACTTCTTTTGATATATCATATCTTAAATTAGACAGCTCCTAAATGAATAGCTTTTCTGTA
GAAAGAGATTTTTAATCTACAGCTTAATTTTCTTCTAAATCGAATGTAATACATACACCC
ACTAATGTTTCAATCAGTTAAAAGCCTCCTAGCAATAAAAATTCATATACATATAGAGAT
ATAAATCCTCCATCGTTTGCACCCAGTTAGCAACCTACTTCTCTAATGAGAGCTAAAGGA
TCATCTAAAGAGTATATAAAGACTGAGCCATGTGATATTGATGTTAATTAAACTCCTAGA
TTAGAGTGTTTGGAAACTGAGAACAATGAAAATACTTCTACAGCAGCATGCTCAAAGTAT
TCAATGAATACTACAAATAGAAGCTTTAACAAAGGATTAAACACTTCTAAATCATTTAGC
AGTTTTATAGCTGACTAAACAAATGAAATAGATAAATATTCTAATAACATACAACTGAAT
TAATAAAATTCTAATATCATAACTAGCTAAATTTCTCCTGTAAAAGTAGGAGATGACTTA
GATGTTTCTAAAATTAAAACGAAAAACGGTTATATTGAGATAACTTCAGATCATTCCCTC
TTAGTAGAATCTTGCAATGGTCGTTTACTCTTTAAAATATCTAAAGATGGATAAAAGGTA
AGATTAATATTTAAAACTATTTTTTATAAACTATTTATTTGTTTTAATAAATAAAGATTT
AAATAAATAAACTAATTGATAAACCTATGGAGAAGCATTACACTCTCAATAACCTTCCCG
CAAAATACTATGCCTTGTACGGATATGCCAAGCAGGTAATTAATGCACTCAAAACTAAAA
AAGTTATATCCAAGCTTGAAAATAAAGAAGGAATTTTTATCCTGTTAGAAAATAACTGTT
TCGAGGCCTAATTTAAAACAGGATACAAAATATATTACAAAAATAAAAATGCTTCAATGA


>TTHERM_00923040(protein)
MITQMIQQKKDQKPKSSSQQVEEEENHLMNSISTSLHNFKITLTLGRGAGSCVFLIEEYK
SGSLYALKTITKQSQYYTNNINRIKNEYNLHSQLDHPNIVKILKRFEDNEYVYMMLEYCP
GGSLFDYVKSKGRLNEDEARDISYQIVQGLEYLHKNKIIHRDLKPGNILLTGNNSVKICD
FGLAVRVTNYESERDTFCGTPNYIAPEICSREKYGIQSDCWSFGCILYTIATGRPPFETV
SIQQTLKMLQKKNKVEYPSHLSKSLVDLIDHILDWNQDTRYNISQIKSHPFYNKSKQNTH
ENEYKLQNPMTFAPPQPFQMEQSVNQNNKNIQQGHTRQRSNFSMDSSNNSKHFQQNKIMN
DNLYQINNINRSNQIQENNVLQNKQTKENRFQSKEQLLVNENKENIHSNILNSINNQQKL
FQQQQKLNPIPLQKSYSYNQKNEQKQDQILHQTLAQGLKKEVSEQSIDNNRNKQIIQEIQ
NISQNSYYNPQISQSNKQQQQQIDTIQQKPQSKTILNTFLNKATKSNSLHQSSSTTPSSN
QQNINTNNFFQSQKSYKNPIVQILNGFPNDSKIQQNQAINHQKNKSLDISGIIPPQPPRP
RDEQKNQLSFKTIDQENIQKKQISIDQSNQNEFVTTPSGNNKMFSQSSNNMIFMKENNNS
KIQNVKKKMSLHFPTEQTNISQDIISTNTTCRNNITTTMTFPSPSSQQFLAQNNNNQIII
NQNIQRQKPSKSTHNNDNNHTSFDISYLKLDSSQMNSFSVERDFQSTAQFSSKSNVIHTP
TNVSISQKPPSNKNSYTYRDINPPSFAPSQQPTSLMRAKGSSKEYIKTEPCDIDVNQTPR
LECLETENNENTSTAACSKYSMNTTNRSFNKGLNTSKSFSSFIADQTNEIDKYSNNIQLN
QQNSNIITSQISPVKVGDDLDVSKIKTKNGYIEITSDHSLLVESCNGRLLFKISKDGQKV
RLIFKTIFYKLFICFNKQRFKQINQLINLWRSITLSITFPQNTMPCTDMPSRQLMHSKLK
KLYPSLKIKKEFLSCQKITVSRPNLKQDTKYITKIKMLQ


>TTHERM_00923040(gene)
GATAGATAGAGAAATCAATTTTGTTTTACAAGGTCTTTTTTTGATAGACATATGATAACT
TAAATGATTCAATAGAAAAAAGATTAAAAGCCAAAAAGTAGCTCTTAGTAAGTTGAAGAA
GAGGAAAATCATTTAATGAATAGTATTTCAACTAGTTTACATGTAAAAACAATACAAAGA
AGAAAAATATAATTAGACTCATTTTTTCCATAATTAATAGAATTTTAAGATTACTTTAAC
TCTTGGTAGAGGCGCAGGAAGTTGCGTTTTTCTAATTGAAGAATACAAATCTGGATCGCT
TTATGTAAATAGAATATTTAATTAAGTATGACATCTTTATAATAGAATATTTATAAAACA
AATTAGGCTTTAAAAACAATCACAAAATAGTCATAATATTACACTAACAATATTAATAGA
ATCAAAAATGAATATAATGTACCTTTTATTTTACAACTATTTTTCAAAGGATTATAATTT
AATTTTAAAAATAAGCTACACTCATAACTAGACCATCCAAACATAGTAAAAATTTTAAAA
AGATTCGAAGACAATGAATATGTATATATGATGCTTGAGTATTGCCCAGGAGGCAGTCTT
TTTGATTATGTAAAAAGTAAAGGAAGGTAAAAAAGCTTTTATCAATAAATATAACGATGC
TTTAGATAGTTTATATCAACTTTTAATTATTTGAAAAAACTAGGCTCAATGAAGATGAAG
CAAGAGACATTTCATATTAAATTGTATAAGGTCTTGAATACTTACACAAAAACAAAATTA
TTCATAGAGATTTAAAGCCTGGTAATATTTTGCTTACTGGGAATAACAGCGTTAAAATTT
GTGATTTCGGGTTAGCTGTAAGAGTAACTAACTACGAATCGGAGAGAGACACATTTTGCG
GAACTCCTAATTACATAGCTCCGTAAAATATAAATTAAAAAAAAATAATTATAATTCATT
ACATATTAATTAAAGAGAAATTTGTAGCAGGGAAAAGTATGGAATATAATCAGATTGCTG
GTCTTTTGGGTGCATTCTATACACTATTGCTACTGGTAGACCTCCTTTTGAAACAGTGAG
TATATAACAAACACTAAAAATGCTATAAAAAAAGAATAAAGTAGAGTATCCTTCTCACTT
ATCTAAATCTTTAGTTGATCTAATTGATCATATACTTGATTGGGTAAATAAATAAATTGA
ATTCTAATCACAATAATAATATACAATAATCATCATATATTTTTACAGATAAATAAATTT
TACAAAAATTTAACTGACTTTTTTTCAAAATTTTAATTTAACAAAATTAATTTTTAACTT
TGCTTTTAAAATTTGAATAGAATTAAGACACAAGATACAATATCAGTTAAATAAAAAGTC
ATCCTTTTTATAATAAATCCAAATAAAATACTCATGAAAATGAATATAAATTATAAAATC
CTATGACTTTTGCTCCTCCTCAACCATTTTAAATGGAATAATCTGTCAATTAAAATAATA
AAAATATTTAACAAGGGCATACTAGGCAAAGATCTAATTTTTCAATGGATTCGTCTAACA
ATTCTAAACATTTTTAATAAAATAAAATAATGAATGATAATTTATATTAAATTAACAATA
TAAATCGCTCCAATCAAATCTAAGAAAATAACGTTTTACAAAATAAACAAACTAAAGAAA
ATAGATTTTAAAGCAAAGAATAATTATTAGTAAATGAAAATAAGGAAAATATCCATTCAA
ATATTCTAAATTCAATTAATAATTAACAAAAATTATTTTAGCAATAACAAAAGTTAAACC
CTATACCACTTTAAAAATCTTACAGCTATAATCAGAAGAACGAGTAAAAGCAAGATTAGA
TATTGCACTAAACTTTAGCTTAAGGCTTAAAGAAGGAAGTAAGTGAATAAAGCATAGATA
ATAATAGAAACAAATAAATAATATAAGAAATTTAAAATATATCATAAAATTCTTATTATA
ATCCATAAATATCCTAATCAAACAAATAGTAATAGCAATAAATAGATACTATTTAGTAAA
AACCATAAAGCAAAACTATATTGAATACATTCTTGAATAAAGCCACTAAATCGAATTCTC
TTCATCAATCGTCATCTACTACTCCCTCAAGCAACTAGCAAAATATCAATACAAATAATT
TTTTTTAATCATAAAAATCTTATAAAAACCCTATAGTATAAATTTTAAATGGATTTCCTA
ATGACTCAAAGATTTAATAAAATCAAGCAATTAATCATTAAAAAAATAAAAGTCTTGATA
TAAGTGGTATAATACCACCTCAACCTCCTCGTCCTCGGGATGAATAAAAAAATCAGCTTA
GTTTTAAAACTATAGATTAAGAAAATATTTAAAAAAAGCAAATATCTATTGATTAATCTA
ACTAAAACGAGTTTGTAACTACTCCAAGTGGAAATAATAAAATGTTTTCTCAATCATCAA
ACAACATGATTTTTATGAAAGAGAACAACAATTCTAAAATATAAAATGTTAAAAAGAAAA
TGAGTCTCCATTTTCCAACTGAATAAACAAATATTAGCCAAGATATAATAAGCACAAACA
CAACATGCAGGAATAACATAACAACAACCATGACCTTTCCTTCTCCTTCGTCTTAATAGT
TTTTAGCATAAAATAATAATAATCAAATAATAATAAATTAAAATATTTAAAGATAAAAAC
CCTCTAAATCAACACATAATAATGATAATAATCACACTTCTTTTGATATATCATATCTTA
AATTAGACAGCTCCTAAATGAATAGCTTTTCTGTAGAAAGAGATTTTTAATCTACAGCTT
AATTTTCTTCTAAATCGAATGTAATACATACACCCACTAATGTTTCAATCAGTTAAAAGC
CTCCTAGCAATAAAAATTCATATACATATAGAGATATAAATCCTCCATCGTTTGCACCCA
GTTAGCAACCTACTTCTCTAATGGTAAAATTATCAAACTTTTTAAAATTTTTTGAATAAA
ATATTTTGTATTTTTTAGATTTATAAGGAAGTTATTTTTTTTAATAAGTTATTTTATCAT
AATTTATTTATAATTAATAATTTAATATTTATTAGAGAGCTAAAGGATCATCTAAAGAGT
ATATAAAGACTGAGCCATGTGATATTGATGTTAATTAAACTCCTAGATTAGAGTGTTTGG
AAACTGAGAACAATGAAAATACTTCTACAGCAGCATGCTCAAAGTATTCAATGAATACTA
CAAATAGAAGCTTTAACAAAGGATTAAACACTTCTAAATCATTTAGCAGTTTTATAGCTG
ACTAAACAAATGAAATAGATAAATATTCTAATAACATACAACTGAATTAATAAAATTCTA
ATATCATAACTAGCTAAATTTCTCCTGTAAAAGTAGGAGATGACTTAGATGTTTCTAAAA
TTAAAACGAAAAACGGTTATATTGAGATAACTTCAGATCATTCCCTCTTAGTAGAATCTT
GCAATGGTCGTTTACTCTTTAAAATATCTAAAGATGGATAAAAGGTAAGATTAATATTTA
AAACTATTTTTTATAAACTATTTATTTGTTTTAATAAATAAAGATTTAAATAAATAAACT
AATTGATAAACCTATGGAGAAGCATTACACTCTCAATAACCTTCCCGCAAAATACTATGC
CTTGTACGGATATGCCAAGCAGGTAATTAATGCACTCAAAACTAAAAAAGTTATATCCAA
GCTTGAAAATAAAGAAGGAATTTTTATCCTGTTAGAAAATAACTGTTTCGAGGCCTAATT
TAAAACAGGATACAAAATATATTACAAAAATAAAAATGCTTCAATGAAAATTAAAGCTCC
TGACAATAACATTTATGAAATTTCTCTTGAAAAAAATTCAAAAGACTTTCCATAAGAAGT
AAAAAACATAACATCTAAATCTCTTAAGTACTATGAATACTTATTAAACTAAAATAAAGA
GTTTTAAAACATATGAAGAAATAAAACCAAAAACTAATTTAAAAACAATTTTCCTAAAAT
AAGTAAATAAATATATTCTTACTATTATCTAATAAAAAATATATAATTAATTTATTGTTA
TCATAAATGTGTTCATAAAAAGAATCAATCTATAAATTTATATATTGTGTAATATAAATA
CGAGTTCT