Identifiers and Description

Gene Model Identifier

TTHERM_01046870

Standard Name

SAK1 (Snk/Plk-Akin Kinase)

Aliases

PreTt05034 | 210.m00041

Description

Snk/Plk-Akin Kinase

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_01046870

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_14077.14.0011977872964304e-148hypothetical protein (927 aa)
OxytrichaContig13304.0.g941.9992362000979228e-56Protein kinase domain
SGDYMR001C3.998181939598921e-51CDC5 Polo-like kinase with mul
tiple functions in mitosis and
cytokinesis through substrate
phosphorylation, also functio
ns in adaptation to DNA damage
during meiosis; has similarit
y to Xenopus Plx1 and S. pombe
Plo1p; possible Cdc28p substr
ate
WormBaseWBGene000040442.000214949834694e-50locus:plk-3 Serine/threonine
-protein kinase plk-3 status
:Confirmed UniProt:Q20845
protein_id:CCD69395.1
DictyBaseDDB_G02926243.001416859614811e-48DDB_G0292624 on chromosome: 6
position 1864394 to 1866302
Stentor CoeruleusSteCoe_46261.462486227251231e-31

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:16933976: Eisen JA, Coyne RS, Wu M, Wu D, Thiagarajan M, Wortman JR, Badger JH, Ren Q, Amedeo P, Jones KM, Tallon LJ, Delcher AL, Salzberg SL, Silva JC, Haas BJ, Majoros WH, Farzad M, Carlton JM, Smith RK, Garg J, Pearlman RE, Karrer KM, Sun L, Manning G, Elde NC, Turkewitz AP, Asai DJ, Wilkes DE, Wang Y, Cai H, Collins K, Stewart BA, Lee SR, Wilamowska K, Weinberg Z, Ruzzo WL, Wloga D, Gaertig J, Frankel J, Tsao CC, Gorovsky MA, Keeling PJ, Waller RF, Patron NJ, Cherry JM, Stover NA,

Sequences

>TTHERM_01046870(coding)
ATGTTTAGTCAAGAAGAGGCCAAAGAATAAAATTCAGATGAGCAGAATCAAGAGATAAAC
GAGTAAGAAAGAAATTCTCTATTCAACTCACTCTCTGCTTAGCTATCTGATTACATCATT
TCTCATCCCATAGGTAGTGGCGCAGGTAGCTTAGTTGTTAAGGTTAAATCAATTAAGACA
AAAAAAGAATATGCTATAAAAGTAGTTGACAAATAAAGTTAGTATTACAAGTCAGCATAC
AAGAGGCTTAAAAATGAAATAGAGATACATCTTGATCTTAAGCACAAAAATATTGTTAAG
ATGATCAAAAGTTTTGAAGACTCAGAAAATTTATATTTAGTTATGGAGTATTGTGAAGGA
GGCGATTTGTTTCATTATTTAAAGCACCACAAAAAACTTTCTGAAACAGAAGCAAAGCGG
ATAACTTATAAATTAGCAGAAGGATTGAAATATCTTCATGACAAATCTATTATCCATAGG
GATTTAAAATTGGGAAATGTTCTTCTTAGTTCTGATCACTAGGTTAAAATTTGCGATTTC
GGATTAGCAGTGAGATTGAATGGAAATGAATAAGAAAAGAATACAATTTGTGGTACTCCG
AACTACATATCTCCAGAAATTCTCAACAAATAACCTTATGGGATGAAAATTGATTGCTGG
TCTTTCGGGTGCATTCTCTATGCATTGATTGTTGGCCATCCGCCATTTTAAGGTTAGGAT
ATTGTTCAAACTTTAAAGAAAGTTACAAGTTAGGAACAGTTTTTTGAGTTGCCAAATAAT
ATTTCTGATAATTTAAAGGACCTTTTAGTCAATATAATCAATTGGAATTAAGATTCGAGG
TTTACTATTGACTAGATTCTTATGCATCCTTTTTATGAAGAAATGAGGCAAAAAAGCGTA
AAGTAGAGATAAGAGGAAGAGGAGTCTCTCTCTTTTTTTAATAGTATAAGGAGTGTAAAA
GGAGAAGACTAAAGAATTAATGTGCATTAAAATGGGGTTAAAAAGATTGACATAAAGTAT
TAAGATAATTTTTTTAATTAGCTCGAACACAAAGAAGGATCTATGCCTAAGAAATCAAAC
AGCCCAACTAATATTCATGAAAGAAAAAATTAAATGATTTATAAAAATGATTAAATAGCT
GCTTTAAAAAATAACAAAATTTAAAATGAAGATTTGAACATAATGAGTAATAATTTAAAC
TAAATACAATATAAAAAGTAATCACAAAATAATTTAGTCAAATAAAATGATAAGCAAATC
CTTAATTAAAAAGAAATCAATTTTGCTAGGAAAAATAGTCCAGTTGATAGGTTCGATGTC
GAAAATCAGTAAAATAACATGAATAAATAAAAAGATGATGCTTCTCATACAGTAAAAGTA
AAAGAAATTCATTCTCATAATCAATAATTAAATATAAGAAAACAAAGTCCTACAAATCAA
ATTTTAAATTATGATAAAGATAAAATAGCTATTCCAGAAAGAAAGAGCTTAACACAATAA
AGTCAAGCAATAAATTAAAATGATGTTTTCAAAAGCCCTAAATTAACATCTAATTAATAA
GAAATTAAATAAACATTCATTAACAATATTGAAAAAATAAAAAGTAATCAACCACCTGTT
CCTCAAAACTAACAGCAATAGAATAATAGTGCAATAACTACTTATGGTGGTTAAGAAAAA
AGGGGAGTTAAATCTATAGTATATAATAATAGCAACAATCAAAATAATATAAATACAAAC
CAAAATAGTAATTAATATAATATTTAAAATAGTATCACTAATAACCAAATTAATCCAACT
AATAATTATAAAACTGTAAATAGTAGCAACATAAATAATAATTATTATAGCAATACAAGC
CAAAGTCAATAGTTCATTAATGGAATTAATCATTAACATGATATTCATAGCAGAACAGCA
GCTAACTCAAATCATGATAAATATATAAAAAACACAAATAACATAAGAAATAACTCTCCT
GTAAATAACAATTCTTACATTGAAAGAAACTAATCTCCAAATACACAAAATAACCATATG
TCAAGCTCCTCTGTTTTGAACAATGGCTAATAATAATCATAACACAAGAATAATAGTTAT
TCTATTTCATAGAGCAAGGTGATTCCACTTCCTAAAAAGGTCCAAACTAGCTTCTTATAG
AACTTAAATTCCCTTACAGATGTAGATAGATTTTCTCCTCCACATAATAATACAAATTCT
ACAAATACAACCACAAATAACTATGTCAACATTTAAAGTGAAATTAACAATTTTCCTCAA
CCTCAAACAGTATCTCATAACAGAACTAAAAATCAAGTTTCTTTTGAAAATAAACCAATT
TAAGCCTAAGTCCAAAATTAAACAACACAAAAAGTAATGTAAAGTAGCGATCAAGGATTC
TACAAGAAAAATAACAATCCTCCTTAATCTGTTCAAACCAACTTATAAAGAAATCAATCA
CCTTAACTGCATGTTGGAAATAAAAATACCAGTGATAATTTAAATTATTATCTTACCAAA
AAGGATCACCCTTAATGTGTGGAGGACTAAGCAGATAAATATGAAGAGATAATTCATTAA
AGAAAAAACGAAAATAAAATAATAAATAGGGAAAACAACATTAAAAGGATCAGTTCTGAA
CAAAACATATCGAGAGTAAGCACTGAATATAAAAATGGAAGCAATGATTTTAATACTTAA
AATAAGTTAAACAACCAATATAATAATAATAAAATAAATATAGACTATACTTCTAATTAA
TTAATGAACAATAACTAATAATACAAAATAAATTAAGAATACAATCAAAATAAATTAAGC
AATGATTTTAGTTCCAATAACAATAAAATGAATAATAACTATGTTTCTAATAAAATAAAT
ACAGAATATAATACAAACAAAATGATTAATCATGACAATCCAAATAGAATGAGCAACGAA
ATCAATAAATCTAACGTTGATCATTATTCAAACAAAAATAATAGCGATTTTAATAAAATA
AATGTTGATTATAACTCGAATAAGATTAATTATGATCCAAATAAAGCAAATATTGATTAT
AGTAGCAATAATAAAATAAATATTGAATTCAACAGTAATAATAAAATAAATAATGGTTAT
GTTTCTAATAAAGTTACTAGTGAAGTTAATAAATATAATTATGAAAGCAACCACAATAAA
TATGGCAATGAATAAAATTAATATAAAATAAAATATGAGTTTAGCAGTCCTAAGATGAAT
ACAGAGCAGAATACTTCTAGATTAAACACAGATTACAAAGGTACAAGATTAAATACTGAC
TTTAATAATACAAGAGACAATACCGAATGTAATACATAGAGACTAAATACAGAGCAAAAT
ACAGCTAGGTTAACCACTGAGTAATATAATCCTCAGAGAGTAATTTCTAAAAATAAAGCT
ATAATGTTCAGTATGGATAATCTCTAAGGTAAGCTAAATATGGAAAATGCCAATAATAGA
ATCTCTGTAGAATAAAACATAAATGGCAGATTTAACAATGAAATAATGAAAACAAATAAT
GAAAACTTAATTTTAAAAAATGGAAACGCTTAAAATATTTTAAACACAAATGCTCATCCT
AAAATTATTGATAAAAAACAGAAATCTGAAGTACCTCTTATTTCACAAATTGCTAATTAA
CCAATGAGATCTTCATAAGTCTAATTAACTTAGTAGCAGCAATAGTAGAATATACCAATT
ACCTTTCTAAACGAAGATAGAGATTTATACAAAAAGCAAGAAAAATTTGATAAAGTAAAA
CATTTTAAAAATTAAACATCTGATAATGCTAACTATAGTCTAAATAACACAAACAATATT
AATGGAAGCAATGAATATAACAAGGAGTTCTTCAATGCTCAATATCAATAATAACTCTAG
GATTAACAAGAAAAAATGATGAATTCTAAAGTAAATACTTACCGCAACTCATAAATTTTT
GAATCCTAGGTTGGCACCTAAAGAGTACAACAATATTCTGTTTAAGCTGTAAAGAGTAAG
TCAAGAATTTAAAGTGGTCTAAAAACTGATGTTAGTGATAGCGAAACAAACAGTATAAGT
AATTAAAATAGTACAACTAATAATTTAGAATATTACGAGTCACCTAGAATAAACACATTA
AATCTTATGCTAAGCCCAGAAAGAAGAATACCAACTACTAATAATAGTACAGCTGTCAAA
AATAATTCTCAAATGAAAAATCTTCTCTCTGGAAACAAGGATAACAGTTCTTGCAAGAAT
AATAGTAATAACACTAGTAAGTATAGTAGATTATCTCCTCTGAAGGTAGGAAGAATACCT
CCAAGTAAAATAACAACTTAAAATGGAACGATAGAAATAACAGAAGGAAGAGAATTCATT
CTTCAGTCAATTTAAAAAAACATAACGATGGTGATTTCTCCAGATGGCAGAGATGTCACG
TTGATAAAGTAAGAAGAGCCTTTAAATAAAAGGTAATACACAATCGATAGATTACCTGAG
AAATATGTTTAATTTTATGATTATTGCAAGAAAATTTGTTAGACACTACAAAAAAATGCA
TAAGATAAATCTGCGAAGGTAAAACTTGAAAACGAAGATGGACAATTCTATTTATATGAG
AATAAATTTGAAGGTGTATTTTCAAATGGTTTTATAGTAAATTATAAATTAAACTCTCAG
AATCTTGAAATACAAACAAATAAATATGCTCCTAAAATTGTTTTTGATTTGCAAAAAGAC
TTAAAGCATGCTTCAAAAGAAATGAAGACAATTGTGCAAAAAACTCAGAAAATAATATCA
ATAATAACTTCAATGAAATCTTGA


>TTHERM_01046870(protein)
MFSQEEAKEQNSDEQNQEINEQERNSLFNSLSAQLSDYIISHPIGSGAGSLVVKVKSIKT
KKEYAIKVVDKQSQYYKSAYKRLKNEIEIHLDLKHKNIVKMIKSFEDSENLYLVMEYCEG
GDLFHYLKHHKKLSETEAKRITYKLAEGLKYLHDKSIIHRDLKLGNVLLSSDHQVKICDF
GLAVRLNGNEQEKNTICGTPNYISPEILNKQPYGMKIDCWSFGCILYALIVGHPPFQGQD
IVQTLKKVTSQEQFFELPNNISDNLKDLLVNIINWNQDSRFTIDQILMHPFYEEMRQKSV
KQRQEEEESLSFFNSIRSVKGEDQRINVHQNGVKKIDIKYQDNFFNQLEHKEGSMPKKSN
SPTNIHERKNQMIYKNDQIAALKNNKIQNEDLNIMSNNLNQIQYKKQSQNNLVKQNDKQI
LNQKEINFARKNSPVDRFDVENQQNNMNKQKDDASHTVKVKEIHSHNQQLNIRKQSPTNQ
ILNYDKDKIAIPERKSLTQQSQAINQNDVFKSPKLTSNQQEIKQTFINNIEKIKSNQPPV
PQNQQQQNNSAITTYGGQEKRGVKSIVYNNSNNQNNINTNQNSNQYNIQNSITNNQINPT
NNYKTVNSSNINNNYYSNTSQSQQFINGINHQHDIHSRTAANSNHDKYIKNTNNIRNNSP
VNNNSYIERNQSPNTQNNHMSSSSVLNNGQQQSQHKNNSYSISQSKVIPLPKKVQTSFLQ
NLNSLTDVDRFSPPHNNTNSTNTTTNNYVNIQSEINNFPQPQTVSHNRTKNQVSFENKPI
QAQVQNQTTQKVMQSSDQGFYKKNNNPPQSVQTNLQRNQSPQLHVGNKNTSDNLNYYLTK
KDHPQCVEDQADKYEEIIHQRKNENKIINRENNIKRISSEQNISRVSTEYKNGSNDFNTQ
NKLNNQYNNNKINIDYTSNQLMNNNQQYKINQEYNQNKLSNDFSSNNNKMNNNYVSNKIN
TEYNTNKMINHDNPNRMSNEINKSNVDHYSNKNNSDFNKINVDYNSNKINYDPNKANIDY
SSNNKINIEFNSNNKINNGYVSNKVTSEVNKYNYESNHNKYGNEQNQYKIKYEFSSPKMN
TEQNTSRLNTDYKGTRLNTDFNNTRDNTECNTQRLNTEQNTARLTTEQYNPQRVISKNKA
IMFSMDNLQGKLNMENANNRISVEQNINGRFNNEIMKTNNENLILKNGNAQNILNTNAHP
KIIDKKQKSEVPLISQIANQPMRSSQVQLTQQQQQQNIPITFLNEDRDLYKKQEKFDKVK
HFKNQTSDNANYSLNNTNNINGSNEYNKEFFNAQYQQQLQDQQEKMMNSKVNTYRNSQIF
ESQVGTQRVQQYSVQAVKSKSRIQSGLKTDVSDSETNSISNQNSTTNNLEYYESPRINTL
NLMLSPERRIPTTNNSTAVKNNSQMKNLLSGNKDNSSCKNNSNNTSKYSRLSPLKVGRIP
PSKITTQNGTIEITEGREFILQSIQKNITMVISPDGRDVTLIKQEEPLNKRQYTIDRLPE
KYVQFYDYCKKICQTLQKNAQDKSAKVKLENEDGQFYLYENKFEGVFSNGFIVNYKLNSQ
NLEIQTNKYAPKIVFDLQKDLKHASKEMKTIVQKTQKIISIITSMKS


>TTHERM_01046870(gene)
ATGTTTAGTCAAGAAGAGGCCAAAGAATAAAATTCAGATGAGCAGAATCAAGAGATAAAC
GAGTAAGAAAGAAATTCTCTATTCAACTCACTCTCTGCTTAGCTATCTGTAAAAAATAAT
ATAAAGCCACATATATTCTACAATTCTAAACTCAAAATTTAAATATTCAAAAGGATTACA
TCATTTCTCATCCCATAGGTAGTGGCGCAGGTAGCTTAGTTGTTAAGGTTAAATCAATTA
AGACAAAAAAAGAATATGTAAAGTTATTTATTCTATTTGATATCTTTACCTTTTAAAAGC
CAAAAATGCTATTAACATTTAATTATAACGAACGAGCACTTCTTGATCATATTTTTTAAA
GGCTATAAAAGTAGTTGACAAATAAAGTTAGTATTACAAGTCAGCATACAAGAGGCTTAA
AAATGAAATAGAGGTAGATTTATTTTTATAGCAAATGAGAGTGATATTTAAGATATTTTG
TTTCAAATTTTAATAAAGATACATCTTGATCTTAAGCACAAAAATATTGTTAAGATGATC
AAAAGTTTTGAAGACTCAGAAAATTTATATTTAGTTATGGAGTATTGTGAAGGAGGCGAT
TTGTTTCATTATTTAAAGCACCACAAAAAGTAATAAGTTAGCTTTTATTAGGAGAATTTA
GTTTAATGGACATCTTTTTTTTGAATTTTTTATTTCTCAAAAGAAATATTCAAACATTAT
GAAAAAGCATTTAGTTAGTAATAGGCATTTCTAATATTTTAAATTATTTATTTATTAGAC
TTTCTGAAACAGAAGCAAAGCGGATAACTTATAAATTAGCAGAAGGATTGAAATATCTTC
ATGACAAATCTATTATCCATAGGGATTTAAAATTGGGAAATGTTCTTCTTAGTTCTGATC
ACTAGGTTAAAATTTGCGATTTCGGATTAGCAGTGAGATTGAATGGAAATGAATAAGAAA
AGAATACAATTTGTGGTACTCCGAACTACATATCTCCGTAATAAATTTACATTTATAAAA
TAACCAAAATAAATATCTTAAAAAATATGATAACCATTATTAAATTAGTTTGTTTTTAAC
CAAAAGAAATGCTTTAAAATCATGAATTTAGTTTTTCGTAAATTTTAAAATTAGAAGGGT
AATTTTAAAAAGAACAAGAAAATAGCTTTGAAAAAAAATACTTCTGTTAATGGAATTTTT
TAAAATATAATAAAAAAAAATAATTTATAGGAAGCTTAATGATAAAAAAATGATTTTAAT
TCTATTTTTCAAAAAATAAGTTCATTTATTTTATCTTAAAAACTAATGAATTTGTCTTGT
GTAAAAATTTCAAGTTTAGATCTTAAGAGAAAAATGATAAAATAAAATGAAAGACATTTA
AGTTTTTTTTGATTGACTTTAAATATAAAATATACTTATATATACTTTATTTTGAATAAA
ATTATTTTTTACTTATAAATTCATATTAAATAAATAATGCTAATTGATATTTTATCTATT
TAATATAGAGAAATTCTCAACAAATAACCTTATGGGATGAAAATTGATTGCTGGTCTTTC
GGGTGCATTCTCTATGCATTGATTGTTGGCCATCCGCCATTTTAAGGTTAGGATATTGTT
CAAACTTTAAAGAAAGTTACAAGTTAGGAACAGTTTTTTGAGTTGCCAAATAATATTTCT
GATAATTTAAAGGACCTTTTAGTCAATATAATCAATTGGGTAGATAATTTTTTTCTCTAA
ATTACTAAATTTCTATTGAAAAATTTCAAATTTTATTAGATTGAAATAATCAATCTTCTA
TTTCAAATTTATTTTATTTTCTATTTCAACAAAGTTGTAAAACTCACTCTTAATTTAATT
ATTATAAATTAGAATTAAGATTCGAGGTTTACTATTGACTAGATTCTTATGCATCCTTTT
TATGAAGAAATGAGGCAAAAAAGCGTAAAGTAGAGATAAGAGGAAGAGGAGTCTCTCTCT
TTTTTTAATAGTATAAGGAGTGTAAAAGGAGAAGACTAAAGAATTAATGTGCATTAAAAT
GGGGTTAAAAAGATTGACATAAAGTATTAAGATAATTTTTTTAATTAGCTCGAACACAAA
GAAGGATCTATGCCTAAGAAATCAAACAGCCCAACTAATATTCATGAAAGAAAAAATTAA
ATGATTTATAAAAATGATTAAATAGCTGCTTTAAAAAATAACAAAATTTAAAATGAAGAT
TTGAACATAATGAGTAATAATTTAAACTAAATACAATATAAAAAGTAATCACAAAATAAT
TTAGTCAAATAAAATGATAAGCAAATCCTTAATTAAAAAGAAATCAATTTTGCTAGGAAA
AATAGTCCAGTTGATAGGTTCGATGTCGAAAATCAGTAAAATAACATGAATAAATAAAAA
GATGATGCTTCTCATACAGTAAAAGTAAAAGAAATTCATTCTCATAATCAATAATTAAAT
ATAAGAAAACAAAGTCCTACAAATCAAATTTTAAATTATGATAAAGATAAAATAGCTATT
CCAGAAAGAAAGAGCTTAACACAATAAAGTCAAGCAATAAATTAAAATGATGTTTTCAAA
AGCCCTAAATTAACATCTAATTAATAAGAAATTAAATAAACATTCATTAACAATATTGAA
AAAATAAAAAGTAATCAACCACCTGTTCCTCAAAACTAACAGCAATAGAATAATAGTGCA
ATAACTACTTATGGTGGTTAAGAAAAAAGGGGAGTTAAATCTATAGTATATAATAATAGC
AACAATCAAAATAATATAAATACAAACCAAAATAGTAATTAATATAATATTTAAAATAGT
ATCACTAATAACCAAATTAATCCAACTAATAATTATAAAACTGTAAATAGTAGCAACATA
AATAATAATTATTATAGCAATACAAGCCAAAGTCAATAGTTCATTAATGGAATTAATCAT
TAACATGATATTCATAGCAGAACAGCAGCTAACTCAAATCATGATAAATATATAAAAAAC
ACAAATAACATAAGAAATAACTCTCCTGTAAATAACAATTCTTACATTGAAAGAAACTAA
TCTCCAAATACACAAAATAACCATATGTCAAGCTCCTCTGTTTTGAACAATGGCTAATAA
TAATCATAACACAAGAATAATAGTTATTCTATTTCATAGAGCAAGGTGATTCCACTTCCT
AAAAAGGTCCAAACTAGCTTCTTATAGAACTTAAATTCCCTTACAGATGTAGATAGATTT
TCTCCTCCACATAATAATACAAATTCTACAAATACAACCACAAATAACTATGTCAACATT
TAAAGTGAAATTAACAATTTTCCTCAACCTCAAACAGTATCTCATAACAGAACTAAAAAT
CAAGTTTCTTTTGAAAATAAACCAATTTAAGCCTAAGTCCAAAATTAAACAACACAAAAA
GTAATGTAAAGTAGCGATCAAGGATTCTACAAGAAAAATAACAATCCTCCTTAATCTGTT
CAAACCAACTTATAAAGAAATCAATCACCTTAACTGCATGTTGGAAATAAAAATACCAGT
GATAATTTAAATTATTATCTTACCAAAAAGGATCACCCTTAATGTGTGGAGGACTAAGCA
GATAAATATGAAGAGATAATTCATTAAAGAAAAAACGAAAATAAAATAATAAATAGGGAA
AACAACATTAAAAGGATCAGTTCTGAACAAAACATATCGAGAGTAAGCACTGAATATAAA
AATGGAAGCAATGATTTTAATACTTAAAATAAGTTAAACAACCAATATAATAATAATAAA
ATAAATATAGACTATACTTCTAATTAATTAATGAACAATAACTAATAATACAAAATAAAT
TAAGAATACAATCAAAATAAATTAAGCAATGATTTTAGTTCCAATAACAATAAAATGAAT
AATAACTATGTTTCTAATAAAATAAATACAGAATATAATACAAACAAAATGATTAATCAT
GACAATCCAAATAGAATGAGCAACGAAATCAATAAATCTAACGTTGATCATTATTCAAAC
AAAAATAATAGCGATTTTAATAAAATAAATGTTGATTATAACTCGAATAAGATTAATTAT
GATCCAAATAAAGCAAATATTGATTATAGTAGCAATAATAAAATAAATATTGAATTCAAC
AGTAATAATAAAATAAATAATGGTTATGTTTCTAATAAAGTTACTAGTGAAGTTAATAAA
TATAATTATGAAAGCAACCACAATAAATATGGCAATGAATAAAATTAATATAAAATAAAA
TATGAGTTTAGCAGTCCTAAGATGAATACAGAGCAGAATACTTCTAGATTAAACACAGAT
TACAAAGGTACAAGATTAAATACTGACTTTAATAATACAAGAGACAATACCGAATGTAAT
ACATAGAGACTAAATACAGAGCAAAATACAGCTAGGTTAACCACTGAGTAATATAATCCT
CAGAGAGTAATTTCTAAAAATAAAGCTATAATGTTCAGTATGGATAATCTCTAAGGTAAG
CTAAATATGGAAAATGCCAATAATAGAATCTCTGTAGAATAAAACATAAATGGCAGATTT
AACAATGAAATAATGAAAACAAATAATGAAAACTTAATTTTAAAAAATGGAAACGCTTAA
AATATTTTAAACACAAATGCTCATCCTAAAATTATTGATAAAAAACAGAAATCTGAAGTA
CCTCTTATTTCACAAATTGCTAATTAACCAATGAGATCTTCATAAGTCTAATTAACTTAG
TAGCAGCAATAGTAGAATATACCAATTACCTTTCTAAACGAAGATAGAGATTTATACAAA
AAGCAAGAAAAATTTGATAAAGTAAAACATTTTAAAAATTAAACATCTGATAATGCTAAC
TATAGTCTAAATAACACAAACAATATTAATGGAAGCAATGAATATAACAAGGAGTTCTTC
AATGCTCAATATCAATAATAACTCTAGGATTAACAAGAAAAAATGATGAATTCTAAAGTA
AATACTTACCGCAACTCATAAATTTTTGAATCCTAGGTTGGCACCTAAAGAGTACAACAA
TATTCTGTAACTTATTTTATTTAATAAATTATTTAAAAAAAAAATAAAACTTTTTAAATG
GAAAAATATATAGTAAATAATAAAATTAATAAATCCCAATTTTTTATAAAATAGGTTTAA
GCTGTAAAGAGTAAGTCAAGAATTTAAAGTGGTCTAAAAACTGATGTTAGTGATAGCGAA
ACAAACAGTATAAGTAATTAAAATAGTACAACTAATAATTTAGAATATTACGAGTCACCT
AGAATAAACACATTAAATCTTATGCTAAGCCCAGAAAGAAGAATACCAACTACTAATAAT
AGTACAGCTGTCAAAAATAATTCTCAAATGAAAAATCTTCTCTCTGGAAACAGTAAATTT
GTTTATTAATTAATGCTTTCTTCATAATTTTAATAAAATAAATGAGTAGAGGATAACAGT
TCTTGCAAGAATAATAGTAATAACACTAGTAAGTATAGTAGATTATCTCCTCTGAAGGTA
GGAAGAATACCTCCAAGTAAAATAACAACTTAAAATGGAACGATAGAAATAACAGAAGGA
AGAGAATTCATTCTTCAGTCAATTTAAAAAAACATAACGATGGTGATTTCTCCAGATGGC
AGAGATGTAATTAAAATTAACTAGCACAATCAAATAGACATAAAAATGAATCATTTTTTA
TTATTTATTAATAGGTCACGTTGATAAAGTAAGAAGAGCCTTTAAATAAAAGGTAATACA
CAATCGATAGATTACCTGAGAAATATGTTTAATTTTATGATTATTGCAAGAAAATTTGTT
AGACACTACAAAAAAATGCATAAGATAAATCTGCGAAGGTAAAACTTGAAAACGAAGATG
GACAATTCTATTTATATGAGAATAAATTTGAAGGTGTATTTTCAAATGGTTTTATAGTAA
ATTATAAATTAAACTCTCAGAATCTTGAAATACAAACAAATAAATATGCTCCTAAAATTG
TTTTTGATTTGCAAAAAGACTTAAAGCATGCTTCAAAAGAAATGAAGACAATTGTGCAAA
AAACTCAGAAAATAATATCAATAATAACTTCAATGAAATCTTGA