Identifiers and Description

Gene Model Identifier

TTHERM_00241840

Standard Name

SAF5 (SWI/SNF-associated factor 5)

Aliases

PreTt18922 | 20.m00386 | 3706.m00150

Description

PHD-finger containing protein. Member of the SWI/SNF complex.

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 19%

TetraMine Data

TTHERM_00241840

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_07810.11.0003491030231826e-151PHD-finger family protein (601
aa)
OxytrichaContig14802.0.g271.0002335610448659e-38PHD-finger
WormBaseWBGene000117292.000769134519826e-18locus:set-16 status:Partiall
y_confirmed UniProt:G5EGI1
protein_id:CAB03348.3
DictyBaseDDB_G02720640.00000000009998509410508463DDB_G0272064 on chromosome: 2
position 1150556 to 1158821
SGDYJR119C0.000000019990673443141236JHD2 JmjC domain family histon
e demethylase specific for H3-
K4 (histone H3 Lys4); removes
methyl groups specifically add
ed by Set1p methyltransferase;
protein levels regulated by N
ot4p (E3 ubiquitin ligase) pol
yubiquitin-mediated degradatio
n

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:29523178: Saettone A, Garg J, Lambert JP, Nabeel-Shah S, Ponce M, Burtch A, Thuppu Mudalige C, Gingras AC, Pearlman RE, Fillingham J (2018) The bromodomain-containing protein Ibd1 links multiple chromatin-related protein complexes to highly expressed genes in Tetrahymena thermophila. Epigenetics & chromatin 11(1):10

Sequences

>TTHERM_00241840(coding)
ATGTAGAAACTCTTAAAATATATCTGCTTATTTATTGTAAACTATTAACTTTCATCTTTT
ATTACTAATAATTTTCTACATTTTCTGTCGCTATATAAAAATTTATTAAATAAAAAGCAA
AGCGAGCGCAGGTTAAGAAATTTAAATAATAAATTCTTAATTTAATTAGATCAAATAAAC
ATATATTTATTATTTTTAGTTAGTTTTCTTTTAGAAAGAAAGAAATTTTTTACGCACGTT
GATTAAATGTTGAATAAATTTGTTCTGGATAAACAAACAGATAGAAATTTCAGTCCGTTT
GATAAATACATTTTTGAGTAATTGCATTTAAATTCTAATAAAATTAATCCCTTTCACACA
GATTGCAAATTTACAAAGAGAAGAGTATGCTATTGCAACTATCATAATAGCTCTTTAATA
GAGCAAAGATCATAAGAGTTAAACGAAGCAGTAAATAGATATTTAAAGGTTGACTATAGT
GGAGCTACAAAGCAAGATTTAAAGAGGTCACTCATAAATAGATAGCTCGCTTAAGAAAAA
GTTAAAAGGTTATAGGATTTAGAAGATTTATTTTACATGGCACCAAAATATGAAAAGTAC
GTTGAAGCTTAAAAAGAAGAGGAAAATGCAATCTTAAGAGAATAAATCATTTAGGAATAA
AAGAACATGATCATTAATGGGCAGTGCTACTATTGTCAAACTACTCATTCAAATAAATTT
TATGAGATAAGTCCTAATCCTGCTGAGACTGTCGTTATCTGTGAAGAATGCGCAATTTCT
AATCATCCTGAAGTAGTTACTTACAATAACAAGCCTGCTTAAAAGCCTGAAAATCTTATC
GAAAAGAAAAAAAAGAGGCAAGAAGCTCAAGCTAAAAGATTACAAACTCTTCAAGCAAAG
AAATTACTCAAAATGGGTACCTTGGATTAAAATTCTAATAAGCAAAATAAATAAGGAAAT
GAAAAAAGCACAACAAAGCTTGACAAAGAAGATGACGAAGATGAAAGTGACATTTCAGAA
ACTTAAAAAGAATGCAATTGGGAAAAATGCAAAAAGAAAAATAAAAGTGATCCTGAAGAC
ATTCTTGTTTGCAAAAATTGCAACAAGAGCTTTCATGCTGAGTGCTGCGATCCTCCTCTT
GAAAAGGGAATAGTTTCAAAGTACGATTGGTTTTGTACAGAATGCAAGCTATGTATTGCT
TGTAACAAAAACACTAAAGAAAATGAATTGCTTATGTGCGACTGTTGTGATAGACCATTC
CACATGAGCTGTTTGGAACCAGCAAGAACTGATATTCCAGAAGGTAGATGGTTTTGTAAA
GATTGTGAAAAATGTCCATGCTGTGGAGTTCTCTTATTCTAAAATTATTCAAGAGAACTG
CTTAAGTAGTATTCAAAATAATAAGTGGATAATAAAATAATATGTAAAGATTGTTGGGTA
TACTACCAATAAAAAAAATACTGTCCTATTTGCTTCAAAATAATAGAAGAAAATGCGGAA
GGCTAGTTTGTGTATTGTGATAAATGTGAATTATGGCTACATTACGAGTGTGAAAAGAAG
CTTAGCAACAGATCCTTTAGAGAAATTAACAGATCAAAATAGTTTTGTTGTAGTAAATGT
AAGGTTATTGAAGACAGTAAGTAAAAATGA


>TTHERM_00241840(protein)
MQKLLKYICLFIVNYQLSSFITNNFLHFLSLYKNLLNKKQSERRLRNLNNKFLIQLDQIN
IYLLFLVSFLLERKKFFTHVDQMLNKFVLDKQTDRNFSPFDKYIFEQLHLNSNKINPFHT
DCKFTKRRVCYCNYHNSSLIEQRSQELNEAVNRYLKVDYSGATKQDLKRSLINRQLAQEK
VKRLQDLEDLFYMAPKYEKYVEAQKEEENAILREQIIQEQKNMIINGQCYYCQTTHSNKF
YEISPNPAETVVICEECAISNHPEVVTYNNKPAQKPENLIEKKKKRQEAQAKRLQTLQAK
KLLKMGTLDQNSNKQNKQGNEKSTTKLDKEDDEDESDISETQKECNWEKCKKKNKSDPED
ILVCKNCNKSFHAECCDPPLEKGIVSKYDWFCTECKLCIACNKNTKENELLMCDCCDRPF
HMSCLEPARTDIPEGRWFCKDCEKCPCCGVLLFQNYSRELLKQYSKQQVDNKIICKDCWV
YYQQKKYCPICFKIIEENAEGQFVYCDKCELWLHYECEKKLSNRSFREINRSKQFCCSKC
KVIEDSKQK


>TTHERM_00241840(gene)
ATGTAGAAACTCTTAAAATATATCTGCTTATTTATTGTAAACTATTAACTTTCATCTTTT
ATTACTAATAATTTTCTACATTTTCTGTCGCTATATAAAAATTTATTAAATAAAAAGCAA
AGCGAGCGCAGGTTAAGAAATTTAAATAATAAATTCTTAATTTAATTAGATCAAATAAAC
ATATATTTATTATTTTTAGTTAGTTTTCTTTTAGAAAGAAAGAAGTAAAAAAGCTTGTTT
TAAATTAGTTTATCAAATTAATAAAAAATAGATTTTTTACGCACGTTGATTAAATGTTGA
ATAAATTTGTTCTGGATAAACAAACAGATAGAAATTTCAGTCCGTTTGATAAATACATTT
TTGAGTAATTGCATTTAAATTCTAATAAAATTAATCCCTTTCACACAGGTAATTTGAGAA
ATAATATCATTTTAAGATATAAAGAGGTGACTTTTGGTAATAAATTCTATTTTTTTAACA
AGATTGCAAATTTACAAAGAGAAGAGTATGCTATTGCAACTATCATAATAGCTCTTTAAT
AGAGCAAAGAGTAAGAATGAAATTTATTACTAAATAAATATTTAAAAAATGTATTTTACT
ATCTATTAATAGTCATAAGAGTTAAACGAAGCAGTAAATAGATATTTAAAGGTTGACTAT
AGTGGAGCTACAAAGCAAGATTTAAAGAGGTCACTCATAAATGTATTATTATTTCTATAG
ATGCAATAAATATAACTAGATTTATAATATTAGAGATAGCTCGCTTAAGAAAAAGTTAAA
AGGTTATAGGATTTAGAAGATTTATTTTACATGGCACCAAAATATGAAAAGTACGTTGAA
GCTTAAAAAGAAGAGGAAAATGCAATCTTAAGAGAATAAATCATTTAGGAATAAAAGAAC
ATGATCATTAATGGGCAGTGCTACTATTGTCAAACTACTCATTCAAATAAATTTTATGAG
ATAAGTCCTGTAATATTTTTTAGATCCTTTAATGAAATAAATATTTAGTTTGGCGGAACA
AAATGCTTGATAAAAATAGATAGAATTTAATAATGAATGTTTTAATTAGAATTTTAATTT
ATAAAATGATTAAATAACAATTTGAAATGCATATCTTTTTAATTAAAATACTGATAGAAT
CCTGCTGAGACTGTCGTTATCTGTGAAGAATGCGCAATTTCTAATCATCCTGAAGTAGTT
ACTTACAATAAGTAATTTATATCAAATATATTTATTAAACTGTCTCACTCTTCTCAATAT
TTTTTTATTATAATTTTAGCAAGCCTGCTTAAAAGCCTGAAAATCTTATCGAAAAGAAAA
AAAAGAGGCAAGAAGCTCAAGCTAAAAGATTACAAACTCTTCAAGCAAAGAAATTACTCA
AAATGGGTACCTTGGATTAAAATTCTAATAAGCAAAATAAATAAGGAAATGAAAAAGTAA
TTAATTAATTTTCCATATTTAGCAAATCAGTATATAAATTAAATATATTTTTAGAGCACA
ACAAAGCTTGACAAAGAAGATGACGAAGATGAAAGTGACATTTCAGAAACTTAAAAAGAA
TGCAATTGGGAAAAATGCAAAAAGAAAAATAAAAGTGATCCTGAAGACATTCTTGTTTGC
AAAAATTGCAACAAGAGCTTTCATGCTGAGTGCTGCGATCCTCCTCTTGAAAAGGGAATA
GTTTCAAAGTACGATTGGTTTTGTACAGAATGCAAGCTATGTATTGCTTGTAACAAAAAC
ACTAAAGTAAATGAAAATAAATTTAATATTCACTTATTTATTTAATTTTGTTAAGATTGA
TTCAAATTATTTTAATCACATTAAGCAAGCAAATTTAAATTTCCCCAAAAAATATTTTAG
GAAAATGAATTGCTTATGTGCGACTGTTGTGATAGACCATTCCACATGAGCTGTTTGGAA
CCAGCAAGAACTGATATTCCAGAAGGTAGATGGTTTTGTAAAGATTGTGAAAAATGTCCA
TGCTGTGGAGTTCTCTTATTCTAAAATTATTCAAGAGAACTGCTTAAGTAGTATTCAAAA
TAATAAGTGGATAATAAAATAATATGTAAAGATTGTTGGGTATACTACCAATAAGTAATT
CTTTAAATAAAATTTTCAAAAAATTATCTTTATTTACCCAAATATAAATAGAAAAAATAC
TGTCCTATTTGCTTCAAAATAATAGAAGAAAATGCGGAAGGCTAGTTTGTGTATTGTGAT
AAATGTGAATTATGTAAATTTAAAATAGATTTTTAATAATAATAGTTTTTAAAATGCCAT
TTTTCAATAATTTAAAATAGGGCTACATTACGAGTGTGAAAAGAAGCTTAGCAACAGATC
CTTTAGAGAAATTAACAGATCAAAATAGTTTTGTTGTAGTAAATGTAAGGTTATTGAAGA
CAGTAAGTAAAAATGA