Identifiers and Description

Gene Model Identifier

TTHERM_00688660

Standard Name

RebL1 (Retinoblastoma binding protein 4/7-like 1 (RebL1))

Aliases

PreTt23161 | 105.m00128 | 3737.m00041 | SSCH1

Description

Ortholog of histone-binding proteins RBBP4 and RBBP7. Contains WD-40 repeats. Subunit of multiple chromatin-related complexes including CAF1, Hat1, Rpd3 (Sin3), and MuvB.

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF00400 ) WD domain, G-beta repeat
  • ( PF08026 ) Bee antimicrobial peptide

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.7%

TetraMine Data

TTHERM_00688660

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_41249.19.997093137033517e-262hypothetical protein (426 aa)
DictyBaseDDB_G02825295.001257666360868e-155rbbD on chromosome: 3 position
5888997 to 5890360
WormBaseWBGene000030361.99972299831384e-147locus:lin-53 Probable histon
e-binding protein lin-53 sta
tus:Confirmed UniProt:P90916
protein_id:CAB03178.1
OxytrichaContig12239.0.g711.999382702437002e-145WD domain, G-beta repeat
SGDYEL056W5.000145777691928e-76HAT2 Subunit of the Hat1p-Hat2
p histone acetyltransferase co
mplex; required for high affin
ity binding of the complex to
free histone H4, thereby enhan
cing Hat1p activity; similar t
o human RbAp46 and 48; has a r
ole in telomeric silencing
Stentor CoeruleusSteCoe_210681.1379798735078682e-50

General Information

Paragraph NoGene NameParagraph Text
145RebL1RebL1 physically interacts with histone H4 and functions in multiple epigenetic regulatory pathways. Genome-wide analyses indicated that RebL1 binds within genic and intergenic regions. RebL1 depletion inhibited cellular growth and reduced the expression levels of multiple genes during Tetrahymena vegetative growth (Nabeel-Shah et al.2021).

Associated Literature

  1. Ref:34086947: Nabeel-Shah S, Garg J, Saettone A, Ashraf K, Lee H, Wahab S, Ahmed N, Fine J, Derynck J, Pu S, Ponce M, Marcon E, Zhang Z, Greenblatt JF, Pearlman RE, Lambert JP, Fillingham J (2021) Functional characterization of RebL1 highlights the evolutionary conservation of oncogenic activities of the RBBP4/7 orthologue in Tetrahymena thermophila. Nucleic acids research ( ):

Sequences

>TTHERM_00688660(coding)
ATGGCTGAAGAATTTAATGATGGTTATGAAAACCAAGCTATTAATGATGAATATAAGATA
TGGAAAAAAAATGCTCCTTTCCTATATGATATAGCAATAACACACGAATTAGAGTGGCCT
TCATTATCTGTATAGTGGCTACCTACTAAAGATATCCCTTAAGAAAGTGACTATGCAATT
CATAAACTGATTTTAGGAACTCATACATCTGGTTAGGATAAAGATTATTTGCTTATTGCC
AAGGTTAGATTGCCACTTGAAGAAACTGCTACAGATATTAGCGAATACCAAAATTAAGCA
AAAGAAGTCGGATAAACTGGTTTGTCAGCTGGAGAAAATAGAATAGAAATAGAAACAAAA
ATATTGCATGATGGAGAAATTAATAGAGCTAGATACATGCCTTAAAAGTATAATGTAATT
GCCACAAAAGTAACAAATGGTGAAATCCATGTTTTTGATTACACATAACATCCTACTACC
CCATAAAATGACTAAGTTCGCCCTTAGCTTAGACTCGTTGGTCATTCAGCAGAAGGTTAT
GGTATTTCTTGGAATCCTAAAAAACAAGGTTATATTGTTTCTGGTGGTTATGATAAAAAA
ATATGTATTTGGAATGTTGAAGCTGCTTCATAATTAAATTCATCTATTAGTCCTCTCCAT
GATATCGAATTTCATAAATCATGTGTAGAAGATGTTGCTTGGCACTAAATAAATCCTGAT
ATATTTGGTTCAGTTAGTGATGATCGTACTGTAGCTATATGGGATATGAGATAAAAATCA
AATGCAGGATTAATCAATCCAACTCATTGTACATAAGCTCATACTGGAGATATTTATTGT
TTAGATTTTAATCCTTTCAACGAATATTTATTTATTACAGGCTCAGAAGATAAAAATATT
GGATTTTGGGATATGAGAAACACATCTAAAAGATTACATACTTTTGTAGGACATACTGAT
CAAGTTTTGAGATGTGAATGGTCACCTTTCAATGTTGGTGTATTTTCTAGTTGTTCTGCT
GATAGAAGAGTTATTGTTTGGGATATCAGCAAATGTGGTTAGGAAATGAAAAATGAAGAT
TTAGTCGATGGACCTCCAGAGCTTCTATTTATGCATGGAGGCCACAGAGCAAAAGTAAAT
GATATCAGTTGGAATCAAAAAGAAAATTTAATTTTAGCTTCAGTTGAAGAAAATAACATA
TTGCAAGTTTGGCAAATGGCTAGAAATATATATGATGATACTGATGATGAAGTAATGAAA
GACTGA


>TTHERM_00688660(protein)
MAEEFNDGYENQAINDEYKIWKKNAPFLYDIAITHELEWPSLSVQWLPTKDIPQESDYAI
HKLILGTHTSGQDKDYLLIAKVRLPLEETATDISEYQNQAKEVGQTGLSAGENRIEIETK
ILHDGEINRARYMPQKYNVIATKVTNGEIHVFDYTQHPTTPQNDQVRPQLRLVGHSAEGY
GISWNPKKQGYIVSGGYDKKICIWNVEAASQLNSSISPLHDIEFHKSCVEDVAWHQINPD
IFGSVSDDRTVAIWDMRQKSNAGLINPTHCTQAHTGDIYCLDFNPFNEYLFITGSEDKNI
GFWDMRNTSKRLHTFVGHTDQVLRCEWSPFNVGVFSSCSADRRVIVWDISKCGQEMKNED
LVDGPPELLFMHGGHRAKVNDISWNQKENLILASVEENNILQVWQMARNIYDDTDDEVMK
D


>TTHERM_00688660(gene)
ATGGCTGAAGGTATATGATAAATTAAAGTTTAATAATATATGATAATAATGCCTATTATA
AATAAATAAATTCCATTATTTCAATCAAGCAAATAAATAAATTGATACTTAATAATGATG
ACTTAGTTAATTAATGATCATTCATTTTAAAATATAAAGAATTTAATGATGGTTATGAAA
ACCAAGCTATTAATGATGAATATAAGATATGGAAAAAAAATGCTCCTTTCCTATATGATA
TAGCAATAACACACGAATTAGAGTGGCCTTCATTATCTGTATAGTGGCTACCTACTAAAG
ATATGTAACAATTTTTATAATTTAAATTAATTAGATGATTAATTAATATTTTTAGAATTC
AAATAATGTTAGTTAAAAAGATAGTTAAAATTTAAAATAGAATACTTAATAACTAAAATA
AATAATTAAAAAAATATTATAGCCCTTAAGAAAGTGACTATGCAATTCATAAACTGATTT
TAGGAACTCATACATCTGGTTAGGATAAAGATTATTTGCTTATTGCCAAGGTAATTAGTT
AATTATATAAGATAAGAAATAATTAAAAGCAATGCTAAATATGTTAGCAGACAAATAAAA
TTAAAAGAAAGTCTTTCAACATATCACATTACATTTGAATATAATAGCTCCTTAAATGAG
ATTCATTTTAAAACAATTGAATTATTTATATTTTAAATTTCCATATAAAGGTTAGATTGC
CACTTGAAGAAACTGCTACAGATATTAGCGAATACCAAAATTAAGCAAAAGAAGTCGGAT
AAACTGGTTTGTCAGCTGGAGAAAATAGAATAGAAATAGAAACAAAAATATTGCATGATG
GAGAAATTAATAGAGCTAGATACATGCCTTAAAAGTATAATGTAATTGCCACAAAAGTAA
CAAATGGTGAAATCCATGTTTTTGATTACACATAACATCCTACTACCCCATAAAATGACT
AAGTTCGCCCTTAGCTTAGACTCGTTGGTCATTCAGCAGAAGGTTATGGTATTTCTTGGA
ATCCTAAAAAACAAGTAAAGATAAAAATAATTTTTAAAGAAATTTTAATTAAAAGCTTTA
TAGTTTTTGATATATTAAATAATTATTAAAATAGATATTTATTGCGATAAATAAAACTTA
TTAAAATTTTTAATTAGGGTTATATTGTTTCTGGTGGTTATGATAAAAAAATATGTATTT
GGAATGTTGAAGCTGCTTCATAATTAAATTCATCTATTAGTCCTCTCCATGATATCGAAT
TTCATAAATCATGTGTAGAAGATGTTGCTTGGCACTAAATAAATCCTGATATATTTGGTT
CAGTTAGTGATGATCGTACTGTAGCTATGTAAAAAATTAATTTTATTTTAAAATTATCTA
AATGATTTTTTACTATTACTTTGATTCATAAGATGCCTTTTTTATTTTCTATTTTCTTGA
TAACCTTTGTTTAAATATTTTTTTTATTTAAAGATGGGATATGAGATAAAAATCAAATGC
AGGATTAATCAATCCAACTCATTGTACATAAGCTCATACTGGAGATATTTATTGTTTAGA
TTTTAATCCTTTCAACGAATATTTATTTATTACAGGCTCAGAAGATAAAAATATTGGATT
TTGGGATATGAGAAACACATCTAAAAGATTACATACTTTTGTAGGACATACTGATCAAGT
AAAGATTCTTAAATTATTTAATTATTGATCAAAATTATTTAGCATAAATAAAAAATTATC
ATTTTTAGGATAGGATAAAATTCTAAATATCAAAATAATTGTTGGATTTATTTATTATCT
TTAAATTTGAAATAACATTTTAAAACTAATTAATTGATGTGAAAATTTTAAATAGGTTTT
GAGATGTGAATGGTCACCTTTCAATGTTGGTGTATTTTCTAGTTGTTCTGCTGATAGAAG
AGTTATTGTTTGGGATATCAGCAAATGTGGTTAGGAAATGAAAAATGAAGATTTAGTCGA
TGGACCTCCAGAGCTTCTATTTATGCATGGAGGCCACAGAGCAAAAGTAAATGATATCAG
TTGGAATCAAAAAGAAAATTTAATTTTAGCTTCAGTTGAAGAAAATAACATATTGCAAGT
TTGGCAAATGGTAAATTTAAATATATTAAATGAATTTAAATAAATAATCTAATTAAAAAA
TAATAAAGGCTAGAAATATATATGATGATACTGATGATGAAGTAATGAAAGACTGA