Identifiers and Description

Gene Model Identifier

TTHERM_00046920

Standard Name

RVB2 (RuVB-like)

Aliases

3.m01992 | PreTt11171 | 3824.m02932

Description

Homolog of yeast ATP-dependent DNA helicase RBV2, also known as reptin

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00046920

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Stentor CoeruleusSteCoe_172990
WormBaseWBGene000206879.997093137033517e-262locus:ruvb-2 status:Confirme
d UniProt:Q9GZH2 protein_i
d:CCD62026.1
Tetrahymena borealisEI9_01762.19.997093137033517e-262TATA box-binding protein (466
aa)
DictyBaseDDB_G02807759.997093137033517e-262rvb2 on chromosome: 3 position
3727138 to 3728652
OxytrichaContig14633.0.g909.997093137033517e-262TIP49 C-terminus
SGDYPL235W9.997093137033517e-262RVB2 Essential protein involve
d in transcription regulation;
component of chromatin remode
ling complexes; required for a
ssembly and function of the IN
O80 complex; also referred to
as reptin; member of the RUVB-
like protein family

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00046920(coding)
ATGGACGTTACAGCTGCTAAAGTTGCCGAAGTTAAGGATCAAACAAGAAACGAAAGAATA
GGTGCCCACTCCCATATCAGAGGTTTGGGTTTGGATGAATCACTTGACCCTAGAAATATT
GGTTAGGGTATGGTTGGATAGAAAGAAGCAAGAAAAGCTGCTGGTATCATTTTAAATATG
ATTAAGGAAGGTAAGATTGCTGGTAGAGGTATTTTAATTGCTGGTTAACCAGGTACCGGT
AAAACTGCAATTGCTATGGGTATGGCTAAATCTTTGGGTGAAGATGTACCTTTCACCATG
TTAGCCGGTTCTGAAATATTCTCTTTGGAAATGTCAAAGTCCGAAGCTCTTACCTAATCC
TTACGTAGATCTATTGGTGTTAGAATCAAAGAAGAAGCTGAAATAGTTGAAGGTGAAGTA
GTTGAAATCGAAATTGAAAAATCTGCAAATAGCGGTGCAAAGACTGGTAAAATTACTTTG
AAGACCACTGAAATGGAAACTGTCTATGACTTGGGTAATAAAATGATCGAAGCTATCTAA
AAAGAAAAGATTGTTGCTGGTGATGTTATTACTATTGATAAGGCTTCAGGTAGAATTTCT
AAGACTGGTCGTTCTTTCGCTCGTGCCAGCGAATTCGATGCCATGGGTCCTTAAACTCGT
TTTGTTTAATGCCCTGAAGGTGAAATCGAAAAGAGAAAGGAAGTTGTCCACACTGTCACT
TTACACGAAATTGATGTTATCAACTCTCGTTCTTAAGGTTTCCTTGCACTTTTCTCTGGT
GATACTGGTGAAATCAAATAAGAAGTCAGAGACCAAATGGACCAAAAGGTTGCTGAATGG
AGAGAAGAAGGAAAGGCAGAAATTGTTCCTGGTGTTCTCTTTATTGACGAAGTCCATATG
CTCGATATGGAATGCTTCTCTTTCTTAAATAGAGCTTTGGAAAGTGAAACAGCTCCCATT
ATTATTTTGGCTACAAACAGAGGTATTACTAACATTAGAGGTACCAACTATAAAGGTCCT
CATGGTATGCCTCTCGATCTCTTGGATAGATTGCTTATCATTACTACCTAACCTTACACT
GAAAAAGAAATTCGTTAAATTATTGATATTCGTTGTGAAGAAGAAGACGTCGAAATGAAT
GATGAAGCTAAGGAAGCTCTTACTACTATTGGTGAATAAACTACTCTCAGATACGCTATT
TAATTAATTACTACCTCTTCTTTGGTTGCAGCCAAAAGAAAATCATAAGAAGTTGATGTT
GTTGATATTAGAAAAGTTTACTCTATGTTTATGGATTTAAAGAGATCTACTGAATACTTG
ATTAACCATCAAAAGGATTATTTATATTCTGAAGAAACAAATGTAACTAAATAAGTAGAA
TAAATGTCTCTTGAGTGA


>TTHERM_00046920(protein)
MDVTAAKVAEVKDQTRNERIGAHSHIRGLGLDESLDPRNIGQGMVGQKEARKAAGIILNM
IKEGKIAGRGILIAGQPGTGKTAIAMGMAKSLGEDVPFTMLAGSEIFSLEMSKSEALTQS
LRRSIGVRIKEEAEIVEGEVVEIEIEKSANSGAKTGKITLKTTEMETVYDLGNKMIEAIQ
KEKIVAGDVITIDKASGRISKTGRSFARASEFDAMGPQTRFVQCPEGEIEKRKEVVHTVT
LHEIDVINSRSQGFLALFSGDTGEIKQEVRDQMDQKVAEWREEGKAEIVPGVLFIDEVHM
LDMECFSFLNRALESETAPIIILATNRGITNIRGTNYKGPHGMPLDLLDRLLIITTQPYT
EKEIRQIIDIRCEEEDVEMNDEAKEALTTIGEQTTLRYAIQLITTSSLVAAKRKSQEVDV
VDIRKVYSMFMDLKRSTEYLINHQKDYLYSEETNVTKQVEQMSLE


>TTHERM_00046920(gene)
ATGGACGTTACAGCTGCTAAAGTTGCCGAAGTTAAGGATCAAACAAGAAACGAAAGAATA
GGTGCCCACTCCCATATCAGAGGTTTGGGTTTGGATGAATCACTTGACCCTAGGTAAAAT
TTTATTTTTAAATTATGAAATATAATTAAAATAATGAGGCTGATTCTAATGTTTATTTTA
TTAATAGAAATATTGGTTAGGGTATGGTTGGATAGGTACTAATTTGAATTTAAAATATGA
TTTTAATATATGCAATGAAGAAAATTAACGATATTCGTTATTGCGCCTTTTTTAAATCTA
GAAAAATATCATTTTAGGCTAATTTATCTCAAAAATTAGTCAGTCACTTACAAATAAATG
AATGATTGCATATTATTTAGAATTTGTTAAAATAAGCAAATTAAACAGGTAAAATTTTTA
AAAATAGAAAGAAGCAAGAAAAGCTGCTGGTATCATTTTAAATATGATTAAGGAAGGTAA
GATTGCTGGTAGAGGTATTTTAATTGCTGGTTAACCAGGTACCGGTAAAACTGCAATTGC
TATGGGTATGGCTAAATCTTTGGGTGAAGATGTACCTTTCACCATGTTAGCCGGTTCTGA
AATATTCTCTTTGGAAATGTCAAAGTCCGAAGCTCTTACCTAATCCTTACGTAGATCTAT
TGGTGTTAGAATCAAAGAAGAAGCTGAAATAGTTGAAGGTGAAGTAGTTGAAATCGAAAT
TGAAAAATCTGCAAGTAAATTTAAAATATTAAATTAATTGTATTTAGTTTTTAATGATTG
AATCAATAAATGAATGTTCTAGACAGCATTTTTTAAATAATTTATATTAATTTATTCGTA
AAGCATAGCAGTTTTAATTTGATTAATGAATATTTTAATTGTAAAATTTAACTGATTAAA
TAAACATAAGCTAAGAGATTAAGTTTAGTTAATCAATCCAGTTTTAAATAATTTAGTCAA
ATTTCAATCTAAAATATTTTATGGTAGTTTAATGTTAATATAATATTTTGATAATAATAA
TAAAGATAGCGGTGCAAAGACTGGTAAAATTACTTTGAAGACCACTGAAATGGAAACTGT
CTATGACTTGGGTAATAAAATGATCGAAGCTATCTAAAAAGAAAAGATTGTTGCTGGTGA
TGTTATTACTATTGATAAGGCTTCAGGTAGAATTTCTAAGACTGGTCGTTCTTTCGCTCG
TGCCAGCGAATTCGATGCCATGGGTCCTTAAACTCGTTTTGTTTAATGCCCTGAAGGTGA
AATCGAAAAGAGAAAGGAAGTTGTCCACACTGTCACTTTACACGAAATTGATGTTATCAA
CTCTCGTTCTTAAGGTTTCCTTGCACTTTTCTCTGGTGATACTGGTGAAATCAAATAAGA
AGTCAGAGACCAAATGGACCAAAAGGTAAATTGAAAAAAATTATTTGAATAGAAATTTAA
AAAAGCTTAAATTATAATTAATTAGGTTGCTGAATGGAGAGAAGAAGGAAAGGCAGAAAT
TGTTCCTGGTGTTCTCTTTATTGACGAAGTCCATATGCTCGATATGGAATGCTTCTCTTT
CTTAAATAGAGCTTTGGAAAGTGAAACAGCTCCCATTATTATTTTGGCTACAAACAGAGG
TATTACTAACATTAGAGGTACCAACTATAAAGGTCCTCATGGTATGCCTCTCGATCTCTT
GGATAGATTGCTTATCATTACTACCTAACCTTACACTGAAAAAGAAATTCGTTAAATTAT
TGATATTCGTTGTGAAGAAGAAGACGTCGAAATGAATGATGAAGCTAAGGAAGCTCTTAC
TACTATTGGTAATTTAAAATAAAAAAATTAGCTTAATTTAAATTTAAACATTTTGTATTA
AAAAGGTGAATAAACTACTCTCAGATACGCTATTTAATTAATTACTACCTCTTCTTTGGT
TGCAGCCAAAAGAAAATCATAAGAAGTTGATGTTGTTGATATTAGAAAAGTAAATACTTG
AGATTAAAAAGATGTTTTTTTTATTTACCATGATTTTAATAATTAGGTTTACTCTATGTT
TATGGATTTAAAGAGATCTACTGAATACTTGATTAACCATCAAAAGGATTATTTATATTC
TGAAGAAACAAATGTAACTAAATAAGTAGAATAAATGTCTCTTGAGTGA