Identifiers and Description

Gene Model Identifier

TTHERM_00476820

Standard Name

RVB1 (RuVB-like)

Aliases

PreTt06210 | 58.m00182 | 3719.m00042

Description

Homolog of yeast ATP-dependent DNA helicase RVB1, also known as pontin

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Domains

  • ( PF06068 ) TIP49 C-terminus
  • ( PF00004 ) ATPase, AAA family
  • ( TIGR01242 ) 26S proteasome subunit P45 family
  • ( PF07728 ) ATPase family associated with various

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.2%

TetraMine Data

TTHERM_00476820

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Stentor CoeruleusSteCoe_162960
WormBaseWBGene000077849.997093137033517e-262locus:ruvb-1 status:Confirme
d UniProt:O17607 protein_i
d:CAB02793.2
Tetrahymena borealisEI9_14183.19.997093137033517e-262TIP49 family protein (455 aa)
DictyBaseDDB_G02932269.997093137033517e-262rvb1 on chromosome: 6 position
2678243 to 2679944
OxytrichaContig13363.0.g119.997093137033517e-262TIP49 C-terminus
SGDYDR190C9.997093137033517e-262RVB1 Essential protein involve
d in transcription regulation;
component of chromatin remode
ling complexes; required for a
ssembly and function of the IN
O80 complex; also referred to
as pontin; member of the RUVB-
like protein family

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00476820(coding)
ATGAAGATCGAAGAAGTAAAATCAACCACAAAGACTTAAAGAATCGCCTCTCACTCTCAC
GTTAAGGGTTTGGGTTTAAATGAAGAAGGTACTGCTGTTGCAGTCGCTTCTGGTATGGTC
GGCCAAGAAAATGCTAGAGAAGCTGCTGGTGTTGTTGTTGAATTAATTAAAACAAAGAAA
ATGGCTGGTAGAGCTGTCCTCTTAGCTGGTCCTCCCGGAACTGGTAAGACTGCTATCTCA
CTTGCCATTTCTTCTGAATTAGGTCCTAAAGTTCCATTCTGCCCAATGGTCGGTTCTGAA
GTTTACTCCACAGAAGTTAAGAAAACTGAAATTCTTATGGAAAACTTCCGTAGAGCAATT
GGTTTAAAGATTAAAGAAACAAAGGAAGTCTGGGAAGGAGAAGTCACTGAACTTAAGACT
GAAGAAAGAGAAGAAGCTTAAGGATACGGTAAAATAGTTAGCAGTGTCATTGTTACTTTG
AAGACTTCTAAAGGTACCAAGCAATTAAAGTTAGATCCTTCTATTTATGAAAATATGCAA
AGAGAAAAAGTTAGTGTTGGTGATGTTATCTACATTGAAGCTTCAAGTGGTAATGTCAAA
AGAGTTGGTAGATGTGACGCTTATGCTTCTGAGTATGATTTAGAAGCTGAAGAATATGTC
CCCTTACCAAAGGGTGATGTACACAAGAAGAAAGAAATTGTGTAAGATATTACTCTCCAT
GACTTGGACGTTGCCAATGCTCGTCCTCAACACGGCTAAGACTTTGTTTCTCTTATGGGT
CAAATCATGAAACCAAAAAAGACTGAAATTACTGAAAAGTTACGTCAATAAATCAACTAA
ATCGTTAATAAATATATTGACTAAGGTATTGCTGAACTTGTCCCTGGTGTGCTCTTTATT
GATGAAGTCCACATGCTTGATATTGAATGTTTCACTTATCTTAACAGAGCCTTAGAATCA
ACTCTTGCTCCTATTGTTATTCTTGCTACCAACAGAGGTATGTGCACCATTAGAGGAACT
GACATAGTATCTCCTCATGGTATTCCTATTGATTTGTTGGACAGACTTTTGATTATCAAG
ACTGTTCCTTACGGATTAGAAGATTTAATTAAAATTCTTGCTATCAGAGCTTCAACTGAA
AGCATCAAATTATCCACTGAAGCTTTATCATTTTTAGGTCAAGTAGGTAGCTCCTCTTCT
CTCAGATATGCAGTTCAACTTTTAACTCCTGCAAGTGTTTTAGCTCAAACAGAAGGAAGA
ACCGAAATTACTAAGGAAGATATTGAAGTTATTAATAAATTATTCTTAGATGCTAAATCT
TCTGCTAAATTATTAAATGAACAAGCAGAAAAGTATATCAGTTGA


>TTHERM_00476820(protein)
MKIEEVKSTTKTQRIASHSHVKGLGLNEEGTAVAVASGMVGQENAREAAGVVVELIKTKK
MAGRAVLLAGPPGTGKTAISLAISSELGPKVPFCPMVGSEVYSTEVKKTEILMENFRRAI
GLKIKETKEVWEGEVTELKTEEREEAQGYGKIVSSVIVTLKTSKGTKQLKLDPSIYENMQ
REKVSVGDVIYIEASSGNVKRVGRCDAYASEYDLEAEEYVPLPKGDVHKKKEIVQDITLH
DLDVANARPQHGQDFVSLMGQIMKPKKTEITEKLRQQINQIVNKYIDQGIAELVPGVLFI
DEVHMLDIECFTYLNRALESTLAPIVILATNRGMCTIRGTDIVSPHGIPIDLLDRLLIIK
TVPYGLEDLIKILAIRASTESIKLSTEALSFLGQVGSSSSLRYAVQLLTPASVLAQTEGR
TEITKEDIEVINKLFLDAKSSAKLLNEQAEKYIS


>TTHERM_00476820(gene)
ATGAAGGTATAAAATAAAATTAATTTATTTGATAAATAAAAATTTAAAGAAATGTGCTGA
GAAAATAAATTTGTTAGTTTTGTAAACTGAAAAATTCTTCAAAAAATAAATACTCCATAA
GCATTTCTTTAAATAGTGAAAATATTTTTGCAGTCGCTCAATGTATTTTAACTAATACTT
TTATTTTATAGATCGAAGAAGTAAAATCAACCACAAAGACTTAAAGAATCGCCTCTCACT
CTCACGTTAAGGGTTTGGGTTTAAATGAAGAAGGTACTGCTGTTGCAGTCGCTTCTGGTA
TGGTCGGCCAAGAAAATGCTAGAGAAGTAATTTAATATTAATTGATAGTTTTAGTATTTA
ATAAAAGCTTAATCCATGTTTCATCTAAAAAATAGAAAAATATAAATTTTCAATATTTCT
ATTTTATAAAATAAACAAGTTATTAAATAAGTTATCAAAAATATGTCTTAAATGAAATAT
AATTTAATGTAAAAAGCATACATCAAACTACATTTAAATGCTTATCTAAGTAGCAAGTGA
TATATTGATTAATTACATTTTTATTATTATAGGCTGCTGGTGTTGTTGTTGAATTAATTA
AAACAAAGAAAATGGCTGGTAGAGCTGTCCTCTTAGCTGGTCCTCCCGGAACTGGTAAGA
CTGCTATCTCACTTGCCATTTCTTCTGAATTAGGTCCTAAAGTTCCATTCTGCCCAATGG
TCGGTTCTGAAGTTTACTCCACAGAAGTTAAGAAAACTGAAATTCTTATGGAAAACTTCC
GTAGAGCAATTGGTTTAAAGATTAAAGAAACAAAGGAAGTCTGGGAAGGAGAAGTCACTG
AACTTAAGACTGAAGAAAGAGAAGAAGCTTAAGGGTATTTTTTTTGTTAATAATTTATAA
GATTAAGAAAAAATAGTGAAGAATACAAATAAATATTTTAACTTGCAAAAAAAATGCAAT
TAAATTTATGAGTGTCTATTTAAAGTTAAAATGAATTTATGTATGATTGCATTTTTAAAT
GGAAGCTCATTTAATTTTAAAATAATTGAAAATAAGTTGTTAAGAAAATTGATTTTATTA
ATAATATTTTTAATAAATTAGATACGGTAAAATAGTTAGCAGTGTCATTGTTACTTTGAA
GACTTCTAAAGGTACCAAGCAATTAAAGTTAGATCCTTCTATTTATGAAAATATGCAAAG
AGAAAAAGTTAGTGTTGGTGATGTTATCTACATTGAAGCTTCAAGTGGTAATGTCAAAAG
AGTTGGTAGATGTGACGCTTATGCTTCTGAGTATGATTTAGAAGCTGAAGAATATGTCCC
CTTACCAAAGGGTGATGTACACAAGAAGAAAGAAATTGTGTAAGATATTACTCTCCATGA
CTTGGACGTTGCCAATGCTCGTCCTCAACACGGCTAAGACTTTGTTTCTCTTATGGGTCA
AATCATGAAACCAAAAAAGACTGAAATTACTGAAAAGTTACGTCAATAAATCAACTAAAT
CGTTAATAAATATATTGACTAAGGTATTGCTGAACTTGTCCCTGGTGTGCTCTTTATTGA
TGAAGTCCACATGCTTGATATTGAATGTTTCACTTATCTTAACAGAGCCTTAGAATCAAC
TCTTGCTCCTATTGTTATTCTTGCTACCAACAGAGGTATGTGCACCATTAGAGGAACTGA
CATAGTATCTCCTCATGGTATTCCTATTGATTTGTTGGACAGGTAATCACTATACTAACT
ATTTATCTTTAATCACATTGCTCTCCTTATCAATTTAATTAATAAATTTTTTTTTTTAAT
AGACTTTTGATTATCAAGACTGTTCCTTACGGATTAGAAGATTTAATTAAAATTCTTGCT
ATCAGAGCTTCAACTGAAAGCATCAAATTATCCACTGAAGCTTTATCATTTTTAGGTCAA
GTAGGTAGCTCCTCTTCTCTCAGATATGCAGTTCAACTTTTAACTCCTGCAAGTGTTTTA
GCTCAAACAGAAGGAAGAACCGAAATTACTAAGTAAATTATTAGTTTTTATTCTAATTTT
GCTAAATAAAATTTCTTGTAAAAATAAAGGGAAGATATTGAAGTTATTAATAAATTATTC
TTAGATGCTAAATCTTCTGCTAAATTATTAAATGAACAAGCAGAAAAGTATATCAGTTGA