Identifiers and Description

Gene Model Identifier

TTHERM_00782040

Standard Name

RSP1 (RNA Silencing Protein 1)

Aliases

PreTt25506 | 131.m00079 | 3813.m01581

Description

Rdn1 associated protein; involved in 23-24 nt small RNA metabolism

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.6%

TetraMine Data

TTHERM_00782040

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_11405.12.0001701965494945e-132hypothetical protein (791 aa)

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:22706992: Talsky KB, Collins K (2012) Strand-asymmetric endogenous Tetrahymena small RNA production requires a previously uncharacterized uridylyltransferase protein partner. RNA (New York, N.Y.) 18(8):1553-62
  2. Ref:19451546: Lee SR, Talsky KB, Collins K (2009) A single RNA-dependent RNA polymerase assembles with mutually exclusive nucleotidyl transferase subunits to direct different pathways of small RNA biogenesis. RNA (New York, N.Y.) 15(7):1363-74
  3. Ref:SUPR000383

Sequences

>TTHERM_00782040(coding)
ATGGATTTGAATTTTTCTGATGATGATGATGAATAGGAAATTTAGCAATAGCAAGAACCT
CAATAGATTGAGGAACTAAATAAACAAGAGGATAATTCTTAATTAGACTAAACAATTTCT
GTCATTAACACAAAAAATTATAAGATTAAAACTTAAACACCATTTTCTGCAGATGAAGTG
TATTCATAAATATATGCCTATCTTGAGAGTAAATAATCTAAATTAGTTTGCATTGAAGTG
AAGATGGAAGTGAATAAAACTGACAAACTTGAAAAATCTAATGATGAAAGCATTTAAATA
ATCAAAGGATCAATAAGCTATGAGTTTTTTAAATTTAGAGAGATAAATGATAAACTAAAA
TTCCCTCCTCCATTAGATATTTACTAAAATAATATAATATTGGAAAACTAAGATGAAGAA
TTCGATTTTAAATTAAATCCCAAATAATATTCTAGATTCCCTTTTATAAATCCATCGAAT
GATATTTTTGAAAAATCTCAAACTTTTGATGTAACAATTTAAGGAGAAGTATTAGGATTT
GAAAAAGTTAAATTGAACGAAGTTTAAGGCTTCGAATTAGAAAAAAAAGATGGCGAAGAT
AAAATAAGCTAAACATTTATTCAATCTTTTGAGACTGCTTAAGCCATTAGTTTAGGATCA
TATGCAAGGGATTAACATAATTATTATTTTGAAAGTCTTTATAATCTTGGAGAGAAGGAG
TGTACATTTATACATCTTGAATAATGCTATGAGTATCATATGTTTACAATTTTCTTAAAC
TTTAGATCGGTTGGCTAAGTAAAAATAGTTTTAGATAAACCTATAATCTAAGTAGAGGGA
TAATATAAGTATCTCATAGCTACCTCTACACCCAAATTCTTTGCAAGCACTTAAACATAT
CACTTAATAAATTTGGTAGAAGATAAGAAGCAATGGTATCCTATACATAATATTTTGCTA
ACTTTACCTAATATTTCAACCTATATGAAAATCTACTCAGCTGAAAATTTTGCTATTAAA
TTAAGTTTAAAAGAAAAAGAAATTAAATAAACAAACAAAGACTAACCTTTTACATAAAAT
ATTTTATAGTTTACTATTGATCTATCATTCTAAATTTAATACATGTTGTTAGTTCTTCTC
TCAAACAAAAAGATAAGCTTGTTTGAGTTTCCTAAATTGCAGTAATGTCTTAAATAAATG
TGTTAAGGAAAGGCGTTTTTTTTCTTGAATAATTTGATGAACAGATAAGAGCACTAGAAA
ATAACTGATTTCTTAAATATTGACGAAAATTAAGTTTTACCAGGTCCAGAATACCAAATA
GTGTACAGAGTCGTTGTTAGTCCTTCTAAATTTAATTTTCTCCTTCCAAGCTCTGAGTAT
AATTCTTATTTAATAAAAGAATTAGAAACTGGAGTAAATGAAACCTAAAATATTGTTAGA
ATTATTTTTGAAGGTAATGAATCTGATTTTATATAGAGTATATATTATAGAGAAATATTA
ATGTCATTTAATATGCTTTCCAAAACTTTTTGTTATTTTGGAAAATAAAATAATGACGCC
TTATTGATTGAGGTAAAAACAATCCCTCAGAACATGCCTAATTTAAAAAAGAAAGATATA
ATGCAACATTATAATAATGAATTATGTCTCAAACTATAAAATGTTGGTGATTACTCTTCA
ATTAAAAATGTATACGAATAACAAATGACGATAAATTAAGCTCTTTGGAAATCTCTTTTT
ATTTTTGACGATAAAGATAAAATCTATAGCATGGAAAATCCTTTTTAATTTGGTTTAATA
AATGATCTTATATATATTAAAATTCTAGAGTAAATTAAACAAGAATTAAATGTTAAAATT
GAAAATATAAATTGCCTTCTGATATAATTAAATGGCTGCACTTCTTTATTCTTTCCTATG
GGCTTAGTTAAAGAGGACATAGTTTAATAATATAAAAAAAATTCCTTTATATTGCCTAGC
GTACATTGCAACCATCAAAGCAACAAGAAAAATAAATTATATTTGATTGATTACAACTAA
TTAGAAAAGGGATGGATTAGTTTAGAAATTTCAAAAAAGATATCTAATTAATTTGAAGTA
GAACATAAATAGTTTTTCAATGATTAAGATTAAATATACGAAACTATCAACTAACTGTTA
CCTTTAGACAATATATTAACTTAATGCTCTTAGAAAGTGTTTAGGAAAAATTTCAATTAA
CTTTTATCAAATAAGTATGATTTATCATAAGAATATTTTTTCATGATATTAAAAGACATC
TTAGCGAATAAAAAAAAAATGCTTTCTCTTGATAACTAAAGAATCTATCCCTAGAACTGT
TTTAGATTATATTCATTTATTGATTAATAATAAGAGCTAAAAGAAGATGAAATTTTTGTT
TAAATATAGTAAAATAATAAATTTTAAATTATTGAAGGTCCAGTTCTTCTAGTTAATGAG
ACTGATTAACAGATAATTATCAAAAAAGTGACTGCAAAATCTGATTTATTCAGTTTGGAT
AGTTATAAAAAATTTAAAAACATTGTGGCGGTGAGCTAATAAAATCTTAATTTATTCAAT
CATAAGCAAAAAATAACTTTGATTTATGGAGAAACAATAAATTAGTTAAAGTTGAATTAG
TAATTAATTTAAAAAGACAAAAAAAATGTAAAAGAATAAGAGGGTATAAATGTAAAAAAG
TCAGCTAAGATATTTTTGGAATCAAAGACAAATAGCAAAGAATCTAAAGAATTTGACTTA
GTAAGACCAAACATTATGAATTAATTCTCTCAGAATTAGTTATTTTTAAAAGCTTTTGAA
GAAGATATTAAAATTGATGAGCATGAAATTATTGAAGCAAAATAAGAAACATTTAAATAG
GCTTTAGCTAATATCGAAAAATATTCTGGAATTTTTAGCCAGTTTAACTAAAAATATGGC
TTGAGTTCAAATTTTAAAATCTATGAATTGCTTTTTGAAGGTAGAAATAATACAGATATA
TAAATTCTATAAGAATTTGAAGATATTTTAGTTAAATTTGCTGATGAAGCTTTTCAGGAA
TCAATTGATCAAGAAATTAATGATAAAAAACTGTTTTATTTAAATTTTAACAAAAAACTA
ATTAAATCTGATGATGATGAAGATTTTCAAGATACCATGTAATGCTTAAAACTTACTTCA
GGCATTTATTATTTATGCTTAATTGCTTGCTTGGCCTATGCTTAAAATAAAAATTTTAAC
GAAATAGCTCAATTAATTTAAGAATAATTCAAATTTGATATTAAAAATTACAATTAATAA
ATTCAAAAAATCTAAGTCAACGATGGTCTCCTGGGATTCTTCTGGATTCTATGTGTTAAA
TAATTCATTTGA


>TTHERM_00782040(protein)
MDLNFSDDDDEQEIQQQQEPQQIEELNKQEDNSQLDQTISVINTKNYKIKTQTPFSADEV
YSQIYAYLESKQSKLVCIEVKMEVNKTDKLEKSNDESIQIIKGSISYEFFKFREINDKLK
FPPPLDIYQNNIILENQDEEFDFKLNPKQYSRFPFINPSNDIFEKSQTFDVTIQGEVLGF
EKVKLNEVQGFELEKKDGEDKISQTFIQSFETAQAISLGSYARDQHNYYFESLYNLGEKE
CTFIHLEQCYEYHMFTIFLNFRSVGQVKIVLDKPIIQVEGQYKYLIATSTPKFFASTQTY
HLINLVEDKKQWYPIHNILLTLPNISTYMKIYSAENFAIKLSLKEKEIKQTNKDQPFTQN
ILQFTIDLSFQIQYMLLVLLSNKKISLFEFPKLQQCLKQMCQGKAFFFLNNLMNRQEHQK
ITDFLNIDENQVLPGPEYQIVYRVVVSPSKFNFLLPSSEYNSYLIKELETGVNETQNIVR
IIFEGNESDFIQSIYYREILMSFNMLSKTFCYFGKQNNDALLIEVKTIPQNMPNLKKKDI
MQHYNNELCLKLQNVGDYSSIKNVYEQQMTINQALWKSLFIFDDKDKIYSMENPFQFGLI
NDLIYIKILEQIKQELNVKIENINCLLIQLNGCTSLFFPMGLVKEDIVQQYKKNSFILPS
VHCNHQSNKKNKLYLIDYNQLEKGWISLEISKKISNQFEVEHKQFFNDQDQIYETINQLL
PLDNILTQCSQKVFRKNFNQLLSNKYDLSQEYFFMILKDILANKKKMLSLDNQRIYPQNC
FRLYSFIDQQQELKEDEIFVQIQQNNKFQIIEGPVLLVNETDQQIIIKKVTAKSDLFSLD
SYKKFKNIVAVSQQNLNLFNHKQKITLIYGETINQLKLNQQLIQKDKKNVKEQEGINVKK
SAKIFLESKTNSKESKEFDLVRPNIMNQFSQNQLFLKAFEEDIKIDEHEIIEAKQETFKQ
ALANIEKYSGIFSQFNQKYGLSSNFKIYELLFEGRNNTDIQILQEFEDILVKFADEAFQE
SIDQEINDKKLFYLNFNKKLIKSDDDEDFQDTMQCLKLTSGIYYLCLIACLAYAQNKNFN
EIAQLIQEQFKFDIKNYNQQIQKIQVNDGLLGFFWILCVKQFI


>TTHERM_00782040(gene)
ATGGATTTGAATTTTTCTGATGATGATGATGAATAGGAAATTTAGCAATAGCAAGAACCT
CAATAGATTGAGGAACTAAATAAACAAGAGGATAATTCTTAATTAGACTAAACAATTTCT
GTCATTAACACAAAAAATTATAAGATTAAAACTTAAACACCATTTTCTGCAGATGAAGTG
TATTCATAAATATATGCCTATCTTGAGAGTAAATAATCTAAATTAGTTTGCATTGAAGTG
AAGATGGAAGTGAATAAAACTGACAAACTTGAAAAATCTAATGATGAAAGCATTTAAATA
ATCAAAGGATCAATAAGCTATGAGTTTTTTAAATTTAGAGAGATAAATGATAAACTAAAA
TTCCCTCCTCCATTAGATATTTACTAAAATAATATAATATGTAATAAAGAATAAATTTAT
TGCATATTTACTAGAATATTAACTTGTATCTTGTATAAATAAAAATAGTGGAAAACTAAG
ATGAAGAATTCGATTTTAAATTAAATCCCAAATAATATTCTAGGTAATTAATAGATTATT
TCTTTTTACTCACTTTCATTATTAAAACAAAATTAGATTCCCTTTTATAAATCCATCGAA
TGATATTTTTGAAAAATCTCAAACTTTTGATGTAACAATTTAAGGAGAAGTATTAGGATT
TGAAAAAGTTAAATTGAACGAAGTTTAAGGCTTCGAATTAGAAAAAAAAGATGGCGAAGA
TGTAAAAATATATTTTTCTAAGCTTCATTTTAACTTAATTTTATTTTTATAGAAAATAAG
CTAAACATTTATTCAATCTTTTGAGACTGCTTAAGCCATTAGTTTAGGATCATATGCAAG
GGATTAACATAATTATTATTTTGAAAGTCTTTATAATCTTGTAATTTATTTTTAAAGACT
TCTAAATAAATTTTATTGTGAATAATTTAAATTAATTTAAAAAAGGGAGAGAAGGAGTGT
ACATTTATACATCTTGAATAATGCTATGAGGTAAAATAATTATTATTTTAGGAACATTAA
CTTTTTCTAATTAACAACAAACAGATAAAAATTTATGTCATTTCTGTTTTTTTATTTAGA
ATTATAAAAATAAATAATAAAATTTAATAATATCACTCAGTTTAATATAATGATTTTAGA
TTAAAATCTTAAGTAATAAAGATAAAATTACAATTTTCATGCAAAATCAATATTTTGATC
TTAAATTATTTTATAACTGCTTGGTTTAGCTCATATAGAAAAAACATAAAATAAAAAATT
TACATAATTAAAAACTAAGAATGGTTAATTTAAAATTTTTTTAAAGCTGAAATAAAGTGT
TGAGAATTATAGAAATTATTTTCTATTTAATTTAATAAAATTATCAATATTTACTTTTGT
TTTAAATAATTAGTATCATATGTTTACAATTTTCTTAAACTTTAGATCGGTTGGCTAAGT
AAAAATAGTTTTAGATAAACCTATAATCTAAGTAGAGGGATAATATAAGTATCTCATAGC
TACCTCTACACCCAAATTCTTTGCAAGCACTTAAACATATCACTTAATAAATTTGGTAGA
AGATAAGAAGCAATGGTATCCTATACATAATATTTTGCTAACTTTACCTAATATTTCAAC
CTATATGAAAATCTACTCAGCTGAAAATTTTGCTATTAAATTAAGTTTAAAAGAAAAAGA
AATTAAATAAACAAACAAAGACTAACCTTTTACATAAAATATTTTATAGTTTACTATTGA
TCTATCATTCTAAATTTAATACATGTTGTTAGTTCTTCTCTCAAACAAAAAGGTAAATTT
GATTTAAAAATAATTATGAATGTTTAAATATTTAATTATATTGAATAGATAAGCTTGTTT
GAGTTTCCTAAATTGCAGTAATGTCTTAAATAAATGTGTTAAGGAAAGGCGTTTTTTTTC
TTGAATAATTTGATGAACAGATAAGAGCACTAGAAAATAACTGATTTCTTAAATATTGTA
ATAATTCTTATTTAAAAATTATATTAAACTTTTTTAACTTTATTAAAGGACGAAAATTAA
GTTTTACCAGGTCCAGAATACCAAATAGTGTACAGAGTCGTTGTTAGTCCTTCTAAATTT
AATTTTCTCCTTCCAAGCTCTGAGTATAATTCTTATTTAATAAAAGAATTAGAAACTGGA
GTAAATGAAACCTAAAATATTGTTAGAATTATTTTTGAAGGTAATGAATCTGATTTTATA
TAGAGTATATATTATAGAGAAATATTAATGTCATTTAATATGCTTTCCAAAACTTTTTGT
TATTTTGGAAAATAAAATAATGACGCCTTATTGATTGAGGTAAAAACAATCCCTCAGAAC
ATGCCTAATTTAAAAAAGAAAGATATAATGCAACATTATAATAATGAATTATGTCTCAAA
CTATAAAATGTTGGTGATTACTCTTCAATTAAAAATGTATACGAATAACAAATGACGATA
AATTAAGCTCTTTGGAAATCTCTTTTTATTTTTGACGATAAAGATAAAATCTATAGCATG
GAAAATCCTTTTTAATTTGGTTTAATAAATGATCTTATATATATTAAAATTCTAGAGGTA
ATTTATTTATTTATTTATTTATTTATTTATTTATTTATTTATTCATTCATTATTTTTGCA
TTAAAGTTTTATTCTTAATTATAATTGAATTTTTTATTAGTTATTTTGATTTAATTATTT
ACTTTAATTAAATTAAGCTATCATATTTTTAAAGAACCTTTCTTTTTGAATTATTTATGT
TTTTTTAATAATGATTGATTTTTATTTTTATTTAAATGATAAATAAATTTATTTAGTTGA
ATTTAAAGGTTTATTTATTATTATAAAAAGTAAATTAAACAAGAATTAAATGTTAAAATT
GAAAATATAAATTGCCTTCTGATATAATTAAATGGCTGCACTTCTTTATTCTTTCCTATG
GGCTTAGTTAAAGAGGACATAGTTTAATAATATAAAAAAAATTCCTTTATATTGCCTAGC
GTACATTGCAACCATCAAAGCAACAAGAAAAATAAATTATATTTGATTGATTACAACTAA
TTAGAAAAGGGATGGATTAGTTTAGAAATTTCAAAAAAGATATCTAATTAATTTGAAGTA
GAACATAAATAGTTTTTCAATGATTAAGATTAAATATACGAAACTATCAACTAACTGTTA
CCTTTAGACAATATATTAACTTAATGCTCTTAGAAAGTGTTTAGGAAAAATTTCAATTAA
CTTTTATCAAATAAGTATGATTTATCATAAGAATATTTTTTCATGATATTAAAAGACATC
TTAGCGAATAAAGTAAATTAATTTTTTTCAAGGTAGTAAAAATTAATATAATTAATATTT
ATTTAAATCATATTTAGAAAAAAATGCTTTCTCTTGATAACTAAAGAATCTATCCCTAGA
ACTGTTTTAGATTATATTCATTTATTGATTAATAATAAGAGCTAAAAGAAGATGAAATTT
TTGTTTAAATATAGTAAAATAATAAATTTTAAATTATTGAAGGTCCAGTTCTTCTAGTTA
ATGAGACTGATTAACAGATAATTATCAAAAAAGTGACTGCAAAATCTGATTTATTCAGTT
TGGATAGTGTAATTAATTTGTAAAAATGATAATAAATATAATATTTCTTTTTATAAAAAG
TATAAAAAATTTAAAAACATTGTGGCGGTGAGCTAATAAAATCTTAATTTATTCAATCGT
AAAAATTAGACAAATGTTATTAAATTGTTTAAAAATTAATTTATAAAAAATAGATAAGCA
AAAAATAACTTTGATTTATGGAGAAACAATAAATTAGTTAAAGTTGAATTAGTAATTAAT
TTAAAAAGACAAAAAAAATGTAAAAGAATAAGAGGGTATAAATGTAAAAAAGTCAGCTAA
GATATTTTTGGAATCAAAGACAAATAGCAAAGGTTTTTTTTTATTTTTAAATTAATTATT
TCAAATAACTTAATAATAATTTAGAATCTAAAGAATTTGACTTAGTAAGACCAAACATTA
TGAATTAATTCTCTCAGAATTAGTTATTTTTAAAAGCTTTTGAAGAAGATATTAAAATTG
ATGAGCATGAAATTATTGAAGCAAAATAAGAAACATTTAAATAGGTAATCACATAATATA
ATTTAATATTAAATTTCATCAATTTTATACTTATAAAAGGCTTTAGCTAATATCGAAAAA
TATTCTGGAATTTTTAGCCAGTTTAACTAAAAATATGGCTTGAGTTCAAATTTTAAAATC
TATGAATTGCTTTTTGAAGGTAGAAATAATACAGATATATAAATTCTATAAGAATTTGAA
GATATTTTAGTTAAATTTGCTGATGAAGCTTTTCAGGAATCAATTGATCAAGAAATTAAT
GATAAAAAACTGTTTTATTTAAATTTTAACAAAAAACTAATTAAATCTGATGATGATGAA
GATGTAAATTTTTTTATTTTCAATTTTATTTTAAAATTTATTTTTAAAAGTTTCAAGATA
CCATGTAATGCTTAAAACTTACTTCAGGCATTTATTATTTATGCTTAATTGCTTGCTTGG
CCTATGCTTAAAATAAAAATTTTAACGAAATAGCTCAATTAATTTAAGAATAATTCAAAT
TTGATATTAAAAATTACAATTAATAAATTCAAAAAATCTAAGTCAACGATGGTCTCCTGG
GATTCTTCTGGATTCTATGTGTTAAATAATTCATTTGA