Identifiers and Description

Gene Model Identifier

TTHERM_00657270

Standard Name

RRS1 (arginyl-tRNA synthetase 1)

Aliases

PreTt02111 | 97.m00097 | 3724.m00005

Description

arginyl-tRNA synthetase family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( PF00750 ) arginyl-tRNA synthetase
  • ( TIGR00456 ) arginyl-tRNA synthetase
  • ( PF05746 ) DALR anticodon binding domain

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 12%

TetraMine Data

TTHERM_00657270

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_16261.19.997093137033517e-262arginyl-tRNA synthetase (617 a
a)
OxytrichaContig21633.0.g191.999275900062694e-162tRNA synthetases class I (R)
WormBaseWBGene000046797.001733352475241e-137locus:rars-1 Probable argini
ne--tRNA ligase, cytoplasmic
status:Confirmed UniProt:Q1
9825 protein_id:CCD65757.1
DictyBaseDDB_G02878037.99705442073232e-89argS2 on chromosome: 5 positio
n 724797 to 727092
Stentor CoeruleusSteCoe_287013.665820411179563e-77
SGDYHR091C3.0011931572567413e-53MSR1 Mitochondrial arginyl-tRN
A synthetase

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00657270(coding)
ATGGAGTCTAAAGTTTTAAAAAGTATGATGAAAATCGCATCTCAACACACATTAAACGTT
GTTAACAATGCTTTGAAGCCCTACAATGTTTAATCTCCTCCTATCAAGATTTAACCTGTT
TCTAACTTAGTTGATGTTGATTACAACACCCCAACTCTCTTGCAAGTCTTCAACCAAAAT
AAAGATAAGAAAACAAAGCAAGCTTTTGGTTTGGCAGACATTAAGGCATTCTGTCATAAG
GTTATTGAATCATTCAATCCTGAAGATAAGGACTGTGCTATCGAAAAGTTAGGTGTTACT
GACTAAGGTTTTTTGACTATTAAGTTAAAATAATAAGTTATTGAAGATGAAATTAACAAT
ATTTTAAAGAATGGTTTGAACTACCCCACTGAAAAGAAACAAAAGATTGCCGTTGATTTC
TCATCTCCTAATATTGCCAAAGAAATGCACGTTGGTCACTTGCGTTCAACTATTATTGGT
GAATCTATTTGCCGTATTTTTGAATTCTAAAACCACGAAGTTCTTCGTATTAACCATTTG
GGTGATTGGGGTACTCAATTCGGTATGCTTATTACTTATATGAAGAGAAAATATCCTAAT
TTCCTCAATGAACCTATTGATTTATCAGATTTAACTATGTTCTACAAGGAATCTAAGAAG
TTATTCGATGAAGATCCTGAATTCAAGAAGACTGCTTAACTTACTGTCGTCGACCTTCAA
AGTGGTGACCCTGAATGTCGCAAGGCTTGGGAAATTCTTTGTGAAATTTCTCGTAGGGAA
TTCACTGAAATCTACAAGCGTTTAGACATTACTTTAGAAGACTTCGGTGAGTCTTTCTAC
AACGATAAAATTCCTGCTGTCATTTAAGACCTCAAGGATGCTGGTATGCTTGTTGAAAGT
GATGGTGCTCAATGTGTTTTCATTGAAAAGTATAAGAACTAACCTCCTCTCTTCATTGTC
AAAAAGGATGGTGGTTACGGATACGATAGTACTGATATGGCCTGCATCAAGTATAGATTA
AAAACTTTGAACTGCAATCGTTTAGTTTACATTACTGATGTTGGATAACAACCTCATTTT
GATTATATTATTGCTGCTGCTGAAAAAATCGGATGGCACGTTCCTCCCACTACTCGTGCT
GAGCATATGGGTTTCGGTATCGTCTAAGGTGAAGACGGTAAGCGTTTCCGTACTCGTTCC
AGTGAAACTGTCAAGCTAAAAGATTTACTTGATGAAGCTAGAGAACGTGCTTTAGAAAAA
ATTAAAGAACGTATTTCAGGTGGTGCTAAAGAAGAAGGTGCTGAAGAAGATGAAGAAGAA
AAAGAAAACAAGGGTAACTACACCAAGCTCTCAGAAGAAGAATATCTTGATGCTGCTGAA
AAGATGGGTATGGCTGCTATTAAATATTACGATTTACGTTAAAACAGAATCAGCAACTAT
AACTTCTCTTATGATAAAATGCTTGACACTAAGGGTAATACTGCTGTCTACTTACTCTAT
TCCTATGCTCGTCTTTGCTCCATCATCCGTAAGAGTGGTGTCTAGTCTGAAGAACTCTGC
AAAATTATCTAAACTTAAGGATTCAAGATTTCTCATCCCCAAGAAAGAATCATTGCTTCC
CTCCTCATAAAGTTCCCTGATGTTCTTGACTAGGTTACTGAAGATTTAGCAATTAATCGT
TTAACTGACTATATGTATGACCTTGCTTGCAAAGTAGCTGAAGGTTATCGTAAATATCAC
ATCAACAATTCTGAAGATAAGCTTACTCGTATCCTTCTCATTGAAGCTACTCGTTAAGTC
CTTGAAAAGTGTTTCTACTTGGTTGGTATCAAGCCCCTTGAAAAAATCTGA


>TTHERM_00657270(protein)
MESKVLKSMMKIASQHTLNVVNNALKPYNVQSPPIKIQPVSNLVDVDYNTPTLLQVFNQN
KDKKTKQAFGLADIKAFCHKVIESFNPEDKDCAIEKLGVTDQGFLTIKLKQQVIEDEINN
ILKNGLNYPTEKKQKIAVDFSSPNIAKEMHVGHLRSTIIGESICRIFEFQNHEVLRINHL
GDWGTQFGMLITYMKRKYPNFLNEPIDLSDLTMFYKESKKLFDEDPEFKKTAQLTVVDLQ
SGDPECRKAWEILCEISRREFTEIYKRLDITLEDFGESFYNDKIPAVIQDLKDAGMLVES
DGAQCVFIEKYKNQPPLFIVKKDGGYGYDSTDMACIKYRLKTLNCNRLVYITDVGQQPHF
DYIIAAAEKIGWHVPPTTRAEHMGFGIVQGEDGKRFRTRSSETVKLKDLLDEARERALEK
IKERISGGAKEEGAEEDEEEKENKGNYTKLSEEEYLDAAEKMGMAAIKYYDLRQNRISNY
NFSYDKMLDTKGNTAVYLLYSYARLCSIIRKSGVQSEELCKIIQTQGFKISHPQERIIAS
LLIKFPDVLDQVTEDLAINRLTDYMYDLACKVAEGYRKYHINNSEDKLTRILLIEATRQV
LEKCFYLVGIKPLEKI


>TTHERM_00657270(gene)
ATGGAGTCTAAAGTTTTAAAAAGTATGATGAAAATCGCATCTCAACACACATTAAACGTT
GTTAACAATGCTTTGAAGCCCTACAATGTTTAATCTCCTCCTATCAAGATTTAACCTGTT
TCTAACTTAGTTGATGTTGATTACAACACCCCAACTCTCTTGCAAGTCTTCAACCAAAAT
AAAGATAAGAAAACAAAGCAAGCTTTTGGTTTGGCAGACATTAAGGCATTCTGTCATAAG
GTTATTGAATCATTCAATCCTGAAGATAAGGTATTAATATATTTATTTATATTTTTTATT
TTCTATCTTTAAAATAGAGATAAAGGTTTAATAATAAATAAAACTTTTTTACAGATCTCT
TAAAGCATATAAAACATGAATCTCATTAAGATTTATCCAAAAAAGAAATTATTAATTTGC
ATTAATGCCAAAAACATCTTTATTATTAGTAAAAATCATATTAATAATTTAAAAGTAATG
AAAATAAAGGAGAAAAAATATAATAAGTTTGATTTTTTGCTATTTTTATTCAAGCTTTTC
AAATTATTTTTAACTTTCTTTAAGTATTAATAAGGAGAGAAGATCTTCGTAATTTTAAAA
TGCAAAGCAAAAAATAAACGATTTTATATTAAAAAACTGCTTTTATATAAAATAGGACTG
TGCTATCGAAAAGTTAGGTGTTACTGACTAAGGTTTTTTGACTATTAAGTTAAAATAATA
AGTTATTGAAGATGAAATTAACAATATTTTAAAGAATGGTTTGAACTACCCCACTGAAAA
GAAACAAAAGATTGCCGTTGATTTCTCATCTCCTAATATTGCCAAAGAAATGCACGTTGG
TCACTTGCGTTCAACTATTATTGGTGAATCTATTTGCCGTATTTTTGAATTCTAAAACCA
CGAAGTTCTTCGTATTAACCATTTGGGTGATTGGGGTACTCAATTCGGTATGCTTATTAC
TTATATGAAGAGAAAATATCCTAATTTCCTCAATGAACCTATTGATTTATCAGATTTAAC
TATGTTCTACAAGGAATCTAAGAAGTTATTCGATGAAGATCCTGAATTCAAGAAGACTGC
TTAACTTACTGTCGTCGACCTTCAAAGTGGTGACCCTGAATGTCGCAAGGCTTGGGAAAT
TCTTTGTGAAATTTCTCGTAGGGAATTCACTGAAATCTACAAGCGTTTAGACATTACTTT
AGAAGACTTCGGTGAGTCTTTCTACAACGATAAAATTCCTGCTGTCATTTAAGACCTCAA
GGATGCTGGTATGCTTGTTGAAAGTGATGGTGCTCAATGTGTTTTCATTGAAAAGTATAA
GAACTAACCTCCTCTCTTCATTGTCAAAAAGGATGGTGGTTACGGATACGATAGTACTGA
TATGGCCTGCATCAAGTATAGATTAAAAACTTTGAACTGCAATCGTTTAGTTTACATTAC
TGATGTTGGATAACAACCTCATTTTGATTATATTATTGCTGCTGCTGAAAAAATCGGATG
GCACGTTCCTCCCACTACTCGTGCTGAGCATATGGGTTTCGGTATCGTCTAAGGTGAAGA
CGGTAAGCGTTTCCGTACTCGTTCCAGTGAAACTGTCAAGCTAAAAGATTTACTTGATGA
AGCTAGAGAACGTGCTTTAGAAAAAATTAAAGAACGTATTTCAGGTGGTGCTAAAGAAGA
AGGTGCTGAAGAAGATGAAGAAGAAAAAGAAAACAAGGGTAACTACACCAAGCTCTCAGA
AGAAGAATATCTTGATGCTGCTGAAAAGATGGGTATGGCTGCTATTAAATATTACGATTT
ACGTTAAAACAGAATCAGCAACTATAACTTCTCTTATGATAAAATGCTTGACACTAAGGG
TAATACTGCTGTCTACTTACTCTATTCCTATGCTCGTCTTTGCTCCATCATCCGTAAGAG
TGGTGTCTAGTCTGAAGAACTCTGCAAAATTATCTAAACTTAAGGATTCAAGATTTCTCA
TCCCCAAGAAAGAATCATTGCTTCCCTCCTCATAAAGTTCCCTGATGTTCTTGACTAGGT
TACTGAAGATTTAGCAATTAATCGTTTAACTGACTATATGTATGACCTTGCTTGCAAAGT
AGCTGAAGGTTATCGTAAATATCACATCAACAATTCTGAAGATAAGCTTACTCGTATCCT
TCTCATTGAAGCTACTCGTTAAGTCCTTGAAAAGTGTTTCTACTTGGTTGGTATCAAGCC
CCTTGAAAAAATCTGA