Identifiers and Description

Gene Model Identifier

TTHERM_00449570

Standard Name

RRP9 (ribosomal RNA processing protein 9)

Aliases

PreTt15470 | 52.m00248 | 3811.m01001

Description

U3 small nucleolar RNA-interacting protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.2%

TetraMine Data

TTHERM_00449570

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_15008.19.997093137033517e-262hypothetical protein (492 aa)
OxytrichaContig11865.0.g867.003229617538552e-69WD domain, G-beta repeat
DictyBaseDDB_G02934127.00308173940364e-57DDB_G0293412 on chromosome: 6
position 2844115 to 2846244
WormBaseWBGene000201715.0020095550341075e-51status:Partially_confirmed U
niProt:A9D0C6 protein_id:CCD
73583.1
SGDYPR137W2.000470901975128e-28RRP9 Protein involved in pre-r
RNA processing, associated wit
h U3 snRNP; component of small
ribosomal subunit (SSU) proce
ssosome; ortholog of the human
U3-55k protein
Stentor CoeruleusSteCoe_137380.0000000000006914400106940203

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00449570(coding)
ATGAACACTAAGAAGCAAAAAGGCAACCTTTTAGGAAAAAGAAAGAACGCCAAATAAGTC
TTATAAAAAAATATTGAAAAAAAGCCATAAAAGAAGAAGGTTGTATAAAATAAAGATCTT
GATGAAGAAATTCTTTCAGATGAAATAGATTCTGTTTCAGGTATGAGCAATGAAGGTGGA
ATCGAAGATCGTTTAATTGAAATAGATGATGAAACTGAGGATAAAAAGAGAATTAGATTG
GCATAGTAAATTTTATAGAAAGCAAAGCTAGATTCATAAAAAGGCAAGAGTTAAAAGTTT
ATTGATAAAATATAAAATACTGGAAATAATGATGTTAGTGATGATGAGTCTTTTGATGAT
GGTGAAGACCACCACAAAAGTGAAGGAGATTCCTTTTAAGGTGTTATTTATGCTGAATCA
ACTCATACTGATGCAATCACAAAGGCTCTTTAAAATGAAATTTTGAAAAAAAGATAGCTC
TAATATACTTTATATGCTGATAAAGTTCAAAAGTATTGGAATAAAATTGGATAAACCTTT
TAATAAAATACTTTAAAAGGTCATACAAGATGTATCACTTCTCTTGAATTCTGTCCAAAT
GGATAATACTTATATTCTGCATCTAAGGATGCCTCCATCATTAGATGGGATTTAACTTAA
ACAGAAAAAAGTAAATAAAAGGAATTCTTAGTTAGAGAAAAAACTACCGATGCTCATAAA
GATGAGATTTTATCAATGAGTATTAATCATCTTGGAAGATATTTAGTTACAGCTAGTAAA
GATAAATCAATCAAGTTATGGGATTTAAAGAAAATGGGATTAATTTAAAATTTCAATGGT
CACAGATAACCTATAAATGCTATTAAATTCGGTATAAACTCAAACCAATTCTGTACTGCA
TCTTCAGACAGATAATTCAAAATGTGGGATGCTTCTGATAAAATATTTATTGATACATTC
TTTGGACATAAGGCTGACCCTACATATATTGACTCTATGAGTGCTAATAATTTCATTAGT
TGTGGCTTTGACAGATAGGTCATCATTTGGAAAACTGAACATTAATCTTAATTGATATAT
GGAGGTCATGACTACTCCATTGATGTTGTAAAAGCAGTAGATGCAGAACATTTTATTACA
GGATCTCAAGATGGATCTATTGCTCTTTGGTCTATTAAGAAGAAAAAACCTATATTTATT
ATGCATAAAGCCCATGGAGGAAGTTGGATTACTGCTTTGGGACATCTTTATAACACTGAT
TTATTTTTTTCTGGCTCTCATGATTAACAAATTAATGCTTATAAAATTGATTTACAATAA
AAGAACTTTTAAAAAATATTTTCCATTCCTTGTAATGGCGTAATAAATGACATACAAATA
TCAATAGATTGTTCTTATCTTGCATGTAAAAAAGTTAATTTGATAGATTATAATTTATTA
AATGAATATTTGTAAAAAAAAGTTAGCGAGTGTGATGAACATAGACTTGGTAGATGGATT
ACAGATAAGAAAGCAAAAAATTAGATTAAGTATTTCAAAATAATGTGA


>TTHERM_00449570(protein)
MNTKKQKGNLLGKRKNAKQVLQKNIEKKPQKKKVVQNKDLDEEILSDEIDSVSGMSNEGG
IEDRLIEIDDETEDKKRIRLAQQILQKAKLDSQKGKSQKFIDKIQNTGNNDVSDDESFDD
GEDHHKSEGDSFQGVIYAESTHTDAITKALQNEILKKRQLQYTLYADKVQKYWNKIGQTF
QQNTLKGHTRCITSLEFCPNGQYLYSASKDASIIRWDLTQTEKSKQKEFLVREKTTDAHK
DEILSMSINHLGRYLVTASKDKSIKLWDLKKMGLIQNFNGHRQPINAIKFGINSNQFCTA
SSDRQFKMWDASDKIFIDTFFGHKADPTYIDSMSANNFISCGFDRQVIIWKTEHQSQLIY
GGHDYSIDVVKAVDAEHFITGSQDGSIALWSIKKKKPIFIMHKAHGGSWITALGHLYNTD
LFFSGSHDQQINAYKIDLQQKNFQKIFSIPCNGVINDIQISIDCSYLACKKVNLIDYNLL
NEYLQKKVSECDEHRLGRWITDKKAKNQIKYFKIM


>TTHERM_00449570(gene)
ATGAACACTAAGAAGCAAAAAGGCAACCTTTTAGGAAAAAGAAAGAACGCCAAATAAGTC
TTATAAAAAAATATTGAAAAAAAGCCAGTAACGAATACTTAAAAATCAATTTTTTTAATT
AGCTACTTTGGTTCATTAATCGATAAATGGATTCATTGGTTTTAGCCATCATAAATTATC
TAAAATATTTTTAAAGAAATGAACTCTAAATTTAATCAAAATTAAAATATTCTATTTTAT
TAATCAAATAGTAAAAGAAGAAGGTTGTATAAAATAAAGATCTTGATGAAGAAATTCTTT
CAGATGAAATAGATTCTGTTTCAGGTATGAGCAATGAAGGTGGAATCGAAGATCGTTTAA
TTGAAATAGATGATGGTAAATAAACTATTAATTGTTTGTTTTCTATATAATAATAAAGAA
GCTTTGCAGGATAAAAGTAGTTAACAGGTGAAGGAAATTTTATGTCAGCTAATAAGTTAA
TTTTTTTGAAATGAGCATGCGAATAAGAGCAAATATTTTAGATATTGTTTCATCATTAAT
TGCTAATATTTACTTAATAAGGGATTTTAAGAATATAAAAAAAGAATTACTTTTACTGCA
AAGAAACTTAAACTTTAGCTTATGATAGGTTTACATTAAAAATTATTTTAAAATTATTCA
AATAGAAACTGAGGATAAAAAGAGAATTAGATTGGCATAGTAAATTTTATAGAAAGCAAA
GCTAGATTCATAAAAAGGCAAGAGTTAAAAGTTTATTGATAAAATATAAAATACTGGAAA
TAATGATGTTAGTGATGATGAGTCTTTTGATGATGGTGAAGACCACCACAAAAGTGAAGG
AGATTCCTTTTAAGGTGTTATTTATGCTGAATCAACTCATACTGATGCAATCACAAAGGC
TCTTTAAAATGAAATTTTGAAAAAAAGATAGCTCTAATATACTTTATATGCTGATAAAGT
AATTATTTAATTAAATAAATAAATAGATAATTAGATAGATTTTTAGCTAGATATTTTCAA
GCAAGTAGAATTAAATTAAATTTATAAATTACTATTTTATAAAAAGGTTCAAAAGTATTG
GAATAAAATTGGATAAACCTTTTAATAAAATACTTTAAAAGGTCATACAAGATGTATCAC
TTCTCTTGAATTCTGTCCAAATGGATAATACTTATATTCTGCATCTAAGGATGCCTCCAT
CATTAGATGGGATTTAACTTAAACAGAAAAAAGTAAATAAAAGGAATTCTTAGTTAGAGA
AAAAACTACCGATGCTCATAAAGATGAGGTAAAATATACACTTTGATATTTAGATAAAAT
AAACACGCTAGCAAATTAAAGATAAATCTTAAATGTAAAAATGTAAAAAAATGATATATT
AGATTGAATGAGTTAGCTTTGAACTTATTTGTAAAAAAAAATTTTATGAAAAAGAAAAAA
AAGTTTTTTAATATTTCAGAATAACTAATTTGATTTTATAATAATTTTAAATTTTTATTA
AATAAGATTTTATCAATGAGTATTAATCATCTTGGAAGATATTTAGTTACAGCTAGTAAA
GATAAATCAATCAAGTTATGGGATTTAAAGAAAATGGGATTAATTTAAAATTTCAATGGT
CACAGATAACCTATAAATGCTATTAAATTCGGTATAAACTCAAACCAATTCTGTACTGCA
TCTTCAGACAGATAATTCAAAATGTGGGATGCTTCTGATAAAATATTTATTGATACATTG
TAAATATAATAATTATAAATGGCCAGTTTTTTAATATATAAATTTGACTTATTCAATAGC
TTTGGACATAAGGCTGACCCTACATATATTGACTCTATGAGTGCTAATAATTTCATTAGT
TGTGGCTTTGACAGATAGGTCATCATTTGGAAAGTAAAAATATTTGGATAATATAATTTT
ATTTAATAAATATAATAAACAAATAGACTGAACATTAATCTTAATTGATATATGGAGGTC
ATGACTACTCCATTGATGTTGTAAAAGCAGTAGATGCAGAACATTTTATTACAGGATCTC
AAGATGGATCTATTGCTCTTTGGTCTATTAAGAAGAAAAAACCTATATTTATTATGCATA
AAGCCCATGGAGGAAGTTGGATTACTGCTTTGGTAAATATTTAAAGCAATAAAAAAATAA
TATTAAATTTATTTTTATTTTTTAATTATTTAGGGACATCTTTATAACACTGATTTATTT
TTTTCTGGCTCTCATGATTAACAAATTAATGCTTATAAAATTGATTTACAATAAAAGAAC
TTTTAAAAAATATTTTCCATTCCTTGTGTAAATAAAAATTTACTTATTTCTTTAAAATTA
ATGAAAAAATATTATTAAAAATAGAATGGCGTAATAAATGACATACAAATATCAATAGAT
TGTTCTTATCTTGCATGTAAAAAAGTTAATTTGATAGATTATAATTTATTAAATGAATAT
TTGTAAAAAAAAGTTAGCGAGTGTGATGAACATAGACTTGGTAGATGGATTACAGATAAG
AAAGCAAAAAATTAGATTAAGTATTTCAAAATAATGTGA