Identifiers and Description

Gene Model Identifier

TTHERM_00085250

Standard Name

RRP8 (ribosomal RNA processing protein 8)

Aliases

PreTt16373 | 6.m00447 | 3836.m02040

Description

RRP8 transmembrane protein putative; ribosomal RNA processing- methyltransferase

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF00036 ) EF hand
  • ( PF08241 ) methyltransferase domain
  • ( PF05148 ) Protein of unknown function (DUF691)
  • ( PF02189 ) Immunoreceptor tyrosine-based activation motif

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.6%

TetraMine Data

TTHERM_00085250

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_02434.19.997093137033517e-262hypothetical protein (645 aa)
OxytrichaContig22670.0.g940.000000019990673443141236EF hand

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00085250(coding)
ATGAAAATGTAGAAATATTAGAACGAAAACTCTAATGTGACACTAGAAATTAATATTACA
ATAGGCAATGATTTTAAGAAAACTCTTACTTACATACAAGGATAAGATCCTGTATTGGCA
GCTAGTTTATTTTGTGAGCAGAATAATTTAAAACCGTCTGCTGTTTACTATATTTAATAA
GCAATAGAGCAAGTTATTTAAAATGTTGATTCGTTTGAAAATGAAAACGAACAACAATCA
TAAATTATTGAAGGAAATTCAAATGACGAATATGATCCAAGATCTTCAGATGAATCAGAA
TATTAAAATTAAAGAAGTATGAAAAAATCTAACATTTATAATAAGCAATACTCAAAAAGT
CCTATTCGCCAAAAAACCAAAACATAAATTCATTTTGGAAGTGATAACAAAATTTATAAT
GGAACAGATTCTGAAAACAGTCATAGAATGTATTAAAATAATTCGTTTAGAATATAAAAT
CCAGGCATAAATCTTTACTAAAAGGGGATGGTTCATCAAATAGTAAAAGAAAAAAAAATG
AAACAAATGCAGATGCAGTAAGAGAAAGATGAATTAAAAGAAGCTACATTTCAGCCACAA
ATAAATTACAACTCTATTTTGTTATATGGCAAGCAAGATTAACAGTAAAGATATGAAAAA
ATAAAGAGAAAGATGGAGGATAAAATGAATATCATTAAATAAAATACTCAATTATAGGAA
TAATTAAAGTGCACATTTTAGCCTTAAATTGGTGTTGTAAGCTCTAGAATTGGTCAGTTT
GCAAAAGAGCACAGAGAAGTTAAAGAAGTTTTTTAGCATCTTTATTTAGATTCATATAGG
AGATAACAAGAAAAAGATAAAAGATAGCAAGAAATAATAGAACTAGAAGAACAGAGGAAT
AAAGAACAATGCCCTTTTACTCCAGAAATAAGTTCAAGCAAAATCTAAAGCTTTAACAAA
CTCTCTTCAGAGAGAAGGATGCTTTAGAATCCATAATAATAAGATTAAGATTTCAGTTAG
CGTCAAGACTTTTATGAAAACTATGATTTGAAAAACTAAGAAAATAATGAAAGTTTCGAT
TTCTCTAAAAACTCAGATGCTATATCATAGCTTAGCTAGTTAACTGAAAGAGAAGGTTTG
CTAGCTCTTCGTCCGAAAATTTAAACACCTATTTGCAGTTATCCAATTTAAGAACCTTAG
TAAGAATTAATGAAAGCATAGCCATAAATTCAAACATAACCGAAGGTTTAATTTCAAAAG
AGTTTCTTTAACTTGGAGAATAAATTTTAGCAAATGAGAAATAGTAAAGAATAAATGAGT
AGTCCAGTTAAAAAGTTTGTAAAACCAGAATAAAAGTAAATTTAAAAGAAAATAAAAAGG
TCAAACTCTTTGAATGTTTGGGAGGATCTGTATAAATAAGCGCAGCAACAAAAAGAAAGC
TAGAAATAAATAGAATTTAAGATAAAACAATAAATATAAAAAGAAATAAACAAGTAAAAA
CTCTCATTAAAAAGCAAGGAAATTATAAATTAATAGCGAGATTAAATAATTGAGTGCATA
TTCTAAGTATTGGATGGAAAAGAAAAAGGATATATAAGCCCAGATAATTTGTGCAGCTAA
TTCCTATCAAATAATTTGAATAAAATACTTAATCCTCTATATGAAGCAATACGTTTGAAT
AATACAATGTTAGACTACTCTCAATTCAATAAAGCAGTGAAATCTCTATATAACTCTATC
GACTTTAATGATAAATTAGTTATTTCTAGAATATTATAAAAAAGATCATAAAGTCTTCCA
AACCATATGTAGTAAGTAATAAATAAATAAATAAATAAATAAATAAAAAAGATATTTTTA
CTCAGAAAACTCTTTCAAAACTATTCATTAATCAATTATGCTTTTTTATTATTCCTTCAA
ATAATATTTAAAGATAGTAATTTTAATTTAATTAAGCTTCAAAAAAATGTTCAATTTGAT
TTAAATTTTTTTTAATTTTTTTTGGTGTTTATTTTTGATATTCTTGGTGATTTTTATAAT
TTTAGAATAAATCCAGCTTGA


>TTHERM_00085250(protein)
MKMQKYQNENSNVTLEINITIGNDFKKTLTYIQGQDPVLAASLFCEQNNLKPSAVYYIQQ
AIEQVIQNVDSFENENEQQSQIIEGNSNDEYDPRSSDESEYQNQRSMKKSNIYNKQYSKS
PIRQKTKTQIHFGSDNKIYNGTDSENSHRMYQNNSFRIQNPGINLYQKGMVHQIVKEKKM
KQMQMQQEKDELKEATFQPQINYNSILLYGKQDQQQRYEKIKRKMEDKMNIIKQNTQLQE
QLKCTFQPQIGVVSSRIGQFAKEHREVKEVFQHLYLDSYRRQQEKDKRQQEIIELEEQRN
KEQCPFTPEISSSKIQSFNKLSSERRMLQNPQQQDQDFSQRQDFYENYDLKNQENNESFD
FSKNSDAISQLSQLTEREGLLALRPKIQTPICSYPIQEPQQELMKAQPQIQTQPKVQFQK
SFFNLENKFQQMRNSKEQMSSPVKKFVKPEQKQIQKKIKRSNSLNVWEDLYKQAQQQKES
QKQIEFKIKQQIQKEINKQKLSLKSKEIINQQRDQIIECIFQVLDGKEKGYISPDNLCSQ
FLSNNLNKILNPLYEAIRLNNTMLDYSQFNKAVKSLYNSIDFNDKLVISRILQKRSQSLP
NHMQQVINKQINKQIKKIFLLRKLFQNYSLINYAFLLFLQIIFKDSNFNLIKLQKNVQFD
LNFFQFFLVFIFDILGDFYNFRINPA


>TTHERM_00085250(gene)
ATGAAAATGTAGAAATATTAGAACGAAAACTCTAATGTGACACTAGAAATTAATATTACA
ATAGGCAATGATTTTAAGAAAACTCTTACTTACATACAAGGATAAGATCCTGTATTGGCA
GCTAGTTTATTTTGTGAGCAGAATAATTTAAAACCGTCTGCTGTTTACTATATTTAATAA
GCAATAGAGCAAGTTATTTAAAATGTTGATTCGTTTGAAAATGAAAACGAACAACAATCA
TAAATTATTGAAGGAAATTCAAATGACGAATATGATCCAAGATCTTCAGATGAATCAGAA
TATTAAAATTAAAGAAGTATGAAAAAATCTAACATTTATAATAAGCAATACTCAAAAAGT
CCTATTCGCCAAAAAACCAAAACATAAATTCATTTTGGAAGTGATAACAAAGTAAATAAA
TCACTAAATTGAATAATTTAATAAATCAAATGTATGCATTAAAAAAAGATTTATAATGGA
ACAGATTCTGAAAACAGTCATAGAATGTATTAAAATAATTCGTTTAGAATATAAAATCCA
GGCATAAATCTTTACTAAAAGGGGATGGTTCATCAAATAGTAAAAGAGTAATTTATAATT
TATATAAATATAGTGCTTTAAATTGGATTATGCTTAAATAAAGAAAAAAAATGAAACAAA
TGCAGATGCAGTAAGAGAAAGATGAATTAAAAGAAGCTACATTTCAGCCACAAATAAATT
ACAACTCTATTTTGTTATATGTAAATAATTTATAAAGAATTATTTATTTATTTATTTAAA
ATAATTTATATAAATTAAAGGGCAAGCAAGATTAACAGTAAAGATATGAAAAAATAAAGA
GAAAGATGGAGGATAAAATGAATATCATTAAATAAAATACTCAATTATAGGAATAATTAA
AGTGCACATTTTAGCCTTAAATTGGTGTTGTGTATGAATTACTAATTTTTCATTCTTACT
TATTTTTGAAAAGAGAATTAAAAAAATAGAAGCTCTAGAATTGGTCAGTTTGCAAAAGAG
CACAGAGAAGTTAAAGAAGTTTTTTAGCATCTTTATTTAGATTCATATAGGAGATAACAA
GAAAAAGATAAAAGATAGCAAGAAATAATAGAACTGTATATTTATTTATTTATTATTTAA
GGATTGCTTTTAGCTTTTTATTTAAGAATGATTTTATTGATTTAATAGAGAAGAACAGAG
GAATAAAGAACAATGCCCTTTTACTCCAGAAATAAGTTCAAGCAAAATCTAAAGCTTTAA
CAAACTCTCTTCAGAGAGAAGGATGCTTTAGAATCCATAATAATAAGATTAAGATTTCAG
TTAGCGTCAAGACTTTTATGAAAACTATGATTTGAAAAACTAAGAAAATAATGAAAGTTT
CGATTTCTCTAAAAACTCAGATGCTATATCATAGCTTAGCTAGTTAACTGAAAGAGAAGG
TTTGCTAGCTCTTCGTCCGAAAATTTAAACACCTATTTGCAGTTATCCAATTTAAGTAAG
ATTTTTTTAATTAAATATTATATGAAATAAAAATTTCTCTTGGTTTTTTTAATTAGGAAC
CTTAGTAAGAATTAATGAAAGCATAGCCATAAATTCAAACATAACCGAAGGTTTAATTTC
AAAAGAGTTTCTTTAACTTGGAGAATAAATTTTAGCAAATGAGAAATAGTAAAGAATAAA
TGAGTAGTCCAGTTAAAAAGTTTGTAAAACCAGAATAAAAGTAAATTTAAAAGAAAATAA
AAAGGTCAAACTCTTTGAATGTTTGGGAGGATCTGTATAAATAAGCGCAGCAACAAAAAG
AAAGCTAGAAATAAATAGAATTTAAGATAAAACAATAAATATAAAAAGAAATAAACAAGT
AAAAACTCTCATTAAAAAGCAAGGAAATTATAAATTAATAGCGAGATTAAATAATTGAGT
GCATATTCTAAGTATTGGATGGAAAAGAAAAAGGATATATAAGCCCAGATAATTTGTGCA
GCTAATTCCTATCAAATAATTTGAATAAAATACTTAATCCTCTATATGAAGCAATACGTT
TGAATAATACAATGTTAGACTACTCTCAATTCAATAAAGCAGTGAAATCTCTATATAACT
CTATCGACTTTAATGATAAATTAGTTATTTCTAGAATATTATAAAAAAGATCATAAAGTC
TTCCAAACCATATGTAGTAAGTAATAAATAAATAAATAAATAAATAAATAAAAAAGATAT
TTTTACTCAGAAAACTCTTTCAAAACTATTCATTAATCAATTATGCTTTTTTATTATTCC
TTCAAATAATATTTAAAGATAGTAATTTTAATTTAATTAAGCTTCAAAAAAATGTTCAAT
TTGATTTAAATTTTTTTTAATTTTTTTTGGTGTTTATTTTTGATATTCTTGGTGATTTTT
ATAATTTTAGAATAAATCCAGCTTGA