Identifiers and Description

Gene Model Identifier

TTHERM_00630430

Standard Name

RRP62 (exosome component RRP6-2)

Aliases

PreTt06556 | 89.m00150 | 3831.m01451

Description

3'-5' exonuclease family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

  • nucleobase-containing compound metabolic process (IEA) | GO:0006139

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00630430

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_04330.19.997093137033517e-2623-5 exonuclease (729 aa)
OxytrichaContig8740.0.1.g101.9998745702418095e-483-5 exonuclease
Stentor CoeruleusSteCoe_71128.985825944049381e-37
DictyBaseDDB_G02785933.000842737734004e-34exdl2B on chromosome: 3 positi
on 240471 to 242531
SGDYOR001W4.998021988471165e-24RRP6 Nuclear exosome exonuclea
se component; has 3-5 exonucle
ase activity; involved in RNA
processing, maturation, survei
llance, degradation, tethering
, and export; has similarity t
o E. coli RNase D and to human
PM-Sc1 100 (EXOSC10); mutant
displays reduced transcription
elongation in the G-less-base
d run-on (GLRO) assay
WormBaseWBGene000007968.000124778438792e-23locus:crn-3 status:Confirmed
UniProt:G5EBX6 protein_id
:CAA90108.1

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00630430(coding)
ATGAAAAATTACACAATTAAAGAGTTTTAACAATATAATCACAGTGTATTAAATCCCTTT
TAGCCTGAAAAGTATATTTTGATAGATACTTTAAATAAGCTGCAGGATTTAATTCCAATA
CTTTTAGAATAAACTAGGTTAGGAATAGATACAGAATAGAGCTTTGCCAAGACCTATGAA
GGATTTTTATGCTTGATACAAATTTCAACTGATTAAAATGACTATCTGATAGATGTTTTA
GGCATCAACAGCAAATAAGGAATTAATGAGTGTCTTTCTAAAGTTTTTTTGTGCAAAGAC
ATTATTAAAATTTTTTATGCTGGATAATAAGATATTTTATGGCTTAAGAGAGATTTTGAT
TTATCAGTAGTAAATTACTTCGATGTAAAAGAATGTGCAAGCTTCCTAAAAAAATCTGAT
GATAATTCACTTATTTAGCTGATTGATCGCTATTGCAATTACAAATTAGATAAGCAAAAG
AAAAAAGAGCTATAAGTTTCAGAGTGGTCAAATAGACCTTTAAGCAAAGAATAGTTAGAC
TATGCTGCTTTGGATTCTCATTACTTAATAAAAATTAGATATGAACTGTTGTGTGAGACT
ATATAAAGTGTCGGTTTTAAGAGAACTATTGAAGTCATTAACTAAATGCAGTAATAAACT
TTAAAGAAATATGAAAAGAAGAAGTTTGATTATTAGTACTTTTTTGATTTATTTTAGAAA
TAATTTAAGCATTAAGAGTTATATGCATCATAAATTGACAAGTAATCAGAAGTATACAGA
ATAATAAACGTAATATATTGTAGAATAGCCAAACTTAAAAATGAATATTCATAATTAAAT
AACTTAAATGCTAATAATTTGTTATTGGAACCTTCGCTTTTAGAACTAGCTTTTAAAATT
TATGATTTAAACAGTAATAAACTTGCTTTGTTGGAAGATTTAGACTTATAAACATTCTAA
AATATCAAATATCCCCAATCGCTTATATTTTTGTAAAGCTAAAGGGAGAAAATCATGTTA
ATTTTGAATTCATGGAATTAGAGTGAAGAAAAAAACAATTTATTATAAGAGTATGATAAA
TATGGATAAAAAAAGGCTAGCAGTCACACTGAAAAAGAAGAAAGGAAGCAGAAGAGAGCA
TAATAATTTGAGGAGTAGTTCTGCTTGAAAAAAGAACCATACGGAAATTGCTAAATTCTA
TCACCACTAGGTTTGAAACTTTGCAATTGTGATGAAAAAAAAGTTAAATGGTATCTCAAT
AAAGGACTAGCTACTTTAGTCAGTAGAGAGCCTTACACAATTATAAAATTAAATTTTTAG
CCTAATGGAAAGAATCATGAAGAATTAGAACAAGAAATTCATTTGAATGAAAACCAATTT
TATGCAAGCAAGAGAGAAACTGTTTGTGTAGTCTGTGGAAAAGATGAAAAATTCACTAAA
TATCATGTTATTCCCTCTATATACAGAACTCATTTTCCAAATAAATACAAAAGCCATAGA
TCTCATGACATTTTGTTATTATGTGTGAAATGTCACCAGAAAGCAGGAAAAAACGCAGAT
TTGTTAAAAGATTAACTATTGCAGTAATATAAAATAGAAAAACAGCAGTATTTTAAATAG
CAAAGCTTAAAATATATGGCTTAAAGAATGTATGCTAGTACTAAGTCATACTTAAAAAGC
AAAGAAAAAATGAATAAAGAAAATAGATAAAAGTGTAAAGAAAACATTAGACAATATTTC
GACGAATTGCTCAAAACACCTGATATTTAAAATAAGTTTCCTTAGTTAAAGGACAAACAA
TTTAAAGTCTCAACCACTGGAAAAATTAAAATTGATGAAGAATTTAGGAGTTTCTTTTCT
AATTTAGAAAAAGACTCTAAAAATATTAAAGATGAAGAAAAACAAAATGAGAGAATTTGG
GCTGGATAAAAAGTAGTTGAAAATTTGAAAACAGAAGATGACATTATTTTATTCATAAAA
ATGTGGAGACAGCACTTTTTAGATGTTATGCAACCAAAATATTTACCATTTGGATGGAAT
GTCAATCATAAATTTACAAGAGATTTTGGTAAAGAGTCTGTTTTCAATTAAATTGAAGGT
AATCAAACAGAAGATATCTCCTAACAAAGCCATATAACTGTTTCTGAAGGAATAAATTAG
CAACCATGA


>TTHERM_00630430(protein)
MKNYTIKEFQQYNHSVLNPFQPEKYILIDTLNKLQDLIPILLEQTRLGIDTEQSFAKTYE
GFLCLIQISTDQNDYLIDVLGINSKQGINECLSKVFLCKDIIKIFYAGQQDILWLKRDFD
LSVVNYFDVKECASFLKKSDDNSLIQLIDRYCNYKLDKQKKKELQVSEWSNRPLSKEQLD
YAALDSHYLIKIRYELLCETIQSVGFKRTIEVINQMQQQTLKKYEKKKFDYQYFFDLFQK
QFKHQELYASQIDKQSEVYRIINVIYCRIAKLKNEYSQLNNLNANNLLLEPSLLELAFKI
YDLNSNKLALLEDLDLQTFQNIKYPQSLIFLQSQREKIMLILNSWNQSEEKNNLLQEYDK
YGQKKASSHTEKEERKQKRAQQFEEQFCLKKEPYGNCQILSPLGLKLCNCDEKKVKWYLN
KGLATLVSREPYTIIKLNFQPNGKNHEELEQEIHLNENQFYASKRETVCVVCGKDEKFTK
YHVIPSIYRTHFPNKYKSHRSHDILLLCVKCHQKAGKNADLLKDQLLQQYKIEKQQYFKQ
QSLKYMAQRMYASTKSYLKSKEKMNKENRQKCKENIRQYFDELLKTPDIQNKFPQLKDKQ
FKVSTTGKIKIDEEFRSFFSNLEKDSKNIKDEEKQNERIWAGQKVVENLKTEDDIILFIK
MWRQHFLDVMQPKYLPFGWNVNHKFTRDFGKESVFNQIEGNQTEDISQQSHITVSEGINQ
QP


>TTHERM_00630430(gene)
ATGAAAAATTACACAATTAAAGAGTTTTAACAATATAATCACAGTGTATTAAATCCCTTT
TAGCCTGAAAAGTATATTTTGATAGATACTTTAAATAAGCTGCAGGATTTAATTCCAATA
CTTTTAGAATAAACTAGGTTAGGTAACTTTTCAAATTTATTTATTTTTACATTGTTTATG
TAAATTATTTATAATATACAGGAATAGATACAGAATAGAGCTTTGCCAAGACCTATGAAG
GATTTTTATGCTTGATACAAATTTCAACTGATTAAAATGACTATCTGATAGATGTTTTAG
GCATCAACAGCAAATAAGGAATTAATGAGTGTCTTTCTAAAGTTTTTTTGTGCAAAGACA
TTATTAAAATTTTTTATGCTGGATAATAAGATATTTTATGGCTTAAGAGAGATTTTGATT
TATCAGTAGTAAATTACTTCGATGTAAAAGAATGTGCAAGCTTCCTAAAAAAATCTGATG
ATAATTCACTTATTTAGCTGATTGATCGCTATTGCAATTACAAATTAGATAAGCAAAAGA
AAAAAGAGCTATAAGTAAATAAATCAGTATTTATTTATATATATTTTTATTTTATTTATT
TTCCAAAAGGTTTCAGAGTGGTCAAATAGACCTTTAAGCAAAGAATAGTTAGACTATGCT
GCTTTGGATTCTCATTACTTAATAAAAATTAGATATGAACTGTTGTGTGAGACTATATAA
AGTGTCGGTTTTAAGAGAACTATTGAAGTCATTAACTAAATGCAGTAATAAACTTTAAAG
AAATATGAAAAGAAGAAGTTTGATTATTAGTACTTTTTTGATTTATTTTAGAAATAATTT
AAGCATTAAGAGTTATATGCATCATAAATTGACAAGTAATCAGAAGTATACAGAATAATA
AACGTAATATATTGTAGAATAGCCAAACTTAAAAATGAATATTCATAATTAAATAACTTA
AATGCTAATAATTTGTTATTGGAACCTTCGCTTTTAGAACTAGCTTTTAAAATTTATGAT
TTAAACAGTAATAAACTTGCTTTGTTGGAAGATTTAGACTTATAAACATTCTAAAATATC
AAATATCCCCAATCGCTTATATTTTTGTAAAGCTAAAGGGAGAAAATCATGTTAATTTTG
AATTCATGGAATTAGAGTGAAGAAAAAAACAATTTATTATAAGAGTATGATAAATATGGA
TAAAAAAAGGCTAGCAGTCACACTGAAAAAGAAGAAAGGAAGCAGAAGAGAGCATAATAA
TTTGAGGAGTAGTTCTGCTTGAAAAAAGAACCATACGGAAATTGCTAAATTCTATCACCA
CTAGGTTTGAAACTTTGCAATTGTGATGAAAAAAAAGTTAAATGGTATCTCAATAAAGGA
CTAGCTACTTTAGTCAGTAGAGAGCCTTACACAATTATAAAATTAAATTTTTAGCCTAAT
GGAAAGAATCATGAAGAATTAGAACAAGAAATTCATTTGAATGAAAACCAATTTTATGCA
AGCAAGAGAGAAACTGTTTGTGTAGTCTGTGGAAAAGATGAAAAATTCACTAAATATCAT
GTTATTCCCTCTATATACAGAACTCATTTTCCAAATAAGTAAATTTCATTTCCTTTCTCA
TAAAATATAAAATAGTTCGATGCATTAAAATAAAATTAAATAGATACAAAAGCCATAGAT
CTCATGACATTTTGTTATTATGTGTGAAATGTCACCAGAAAGCAGGAAAAAACGCAGATT
TGTTAAAAGATTAACTATTGCAGTAATATAAAATAGAAAAACAGCAGTATTTTAAATAGC
AAAGCTTAAAATATATGGCTTAAAGAATGTATGCTAGTACTAAGTCATACTTAAAAAGCA
AAGAAAAAATGAATAAAGAAAATAGATAAAAGTGTAAAGAAAACATTAGACAATATTTCG
ACGAATTGCTCAAAACACCTGATATTTAAAATAAGTTTCCTTAGTTAAAGGACAAACAAT
TTAAAGTCTCAACCACTGGAAAAATTAAAATTGATGAAGAATTTAGGAGTTTCTTTTCTA
ATTTAGAAAAAGACTCTAAAAATATTAAAGATGAAGAAAAACAAAATGAGAGAATTTGGG
CTGGATAAAAAGTAGTTGAAAATTTGAAAACAGAAGATGACATTATTTTATTCATAAAAA
TGTGGAGACAGCACTTTTTAGATGTTATGCAACCAAAATATTTACCATTTGGATGGAATG
TCAATCATAAATTTACAAGAGATTTTGGTAAAGAGTCTGTTTTCAATTAAATTGAAGGTA
ATCAAACAGAAGATATCTCCTAACAAAGCCATATAACTGTTTCTGAAGGAATAAATTAGC
AACCATGA