Identifiers and Description

Gene Model Identifier

TTHERM_00961910

Standard Name

RRP5 (rRNA processing protein 5)

Aliases

PreTt23679 | 178.m00060

Description

pre-rRNA processing protein RRP5

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.6%

TetraMine Data

TTHERM_00961910

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_15853.19.997093137033517e-262S1 RNA binding domain-containi
ng protein (2056 aa)
OxytrichaContig5641.0.g709.997105718980434e-168S1 RNA binding domain
SGDYMR229C5.001636743996964e-56RRP5 RNA binding protein with
preference for single stranded
tracts of Us involved in synt
hesis of both 18S and 5.8S rRN
As; component of both the ribo
somal small subunit (SSU) proc
essosome and the 90S preriboso
me
DictyBaseDDB_G02901818.003186242472315e-51DDB_G0290181 on chromosome: 5
position 3746723 to 3749553
WormBaseWBGene000028507.003455847728069e-40locus:let-716 status:Partial
ly_confirmed UniProt:Q18038
protein_id:CCD63223.1
Stentor CoeruleusSteCoe_328700.000000000013887943864964021

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00961910(coding)
ATGGCTCCTATAAATAATAAATCATAATAAAAGGGTAAACCACACCCAGCTAAGGGCGGT
AGATAAAATCAATAAGACAAGCCCAAAAGAAAAGTTCCAGCTTGGGAAAACAAATTTAAA
GATGAAATAGTAGATTATTTTGATGGTGCTCAAGACGCAGATGGTGAGCAAATGTTTAAT
AAAATGCCCATTCTTAAGGAAAACAACAGGGTTATGAAGCCATCCAAGAAAGCAAAAAAT
TTAAAATAAAAGAGTGACATTATAAATTCAGATGACGAGTTTGAAAGAATGATGATGGGA
GGTTAGTCTAAAAAATTAAAATCTGCTGACGACGACATTTTCGGAGGAGAATCAGGCTTA
TTCACTGCTGGTGAATAGTCTTTCAGCAATTTCTTTATTTAAAATAAATATGCTTTACTT
CAACTTGAAAAAGTCCCAGTCCTTAGATATTCTCCTGGAACTTAAGTTTTAACTGCTGTC
AGCGAATATGGTTCAAACGGACAATATATGGTTGTTAACTTATCAAGAAATAAAAAGGCT
TTCGTCACTGTTGCTGATGCTACAGAAGCAAGCAAGGAAGAAAATGATTTAAGAATTTAT
GATTAAGGTGAATATTTGATTGGTGAAATAGTTCCTAGCATTAAGGAAGGAAACATGAAT
GTTTCAATTAAGACTTCTAAGGTCAATAGCGGACTTTAAATTAGCGATATTCATTTAAAT
ATGATTTTACCAGGTCTTGTTTCAAGCAAAGAAGACCACGGTGCCAAGATTGAATTCAAT
GGAGGCGAGAAGTACTTTGGCTTTTTATCAAAAGATGAAGCTAATAACTTTGAGGATTTA
GAAGAAGGTAGAGTTTATATGTTCAGAGTTATTAAGAAAGAAGAAAAGAAGAGATTAGTT
CATTTAAGTCAAAAGGTTTCTGATTAGGAAGGAAAGTTTGTTGTTAGCGGCGAAGTTGAC
ATTGAAGATGGTGCCGATTTACATCACTTAGCTAAGCCTGGTAACCTTGTCAATGCTGTC
ATTTTAAAGGTTTTGAACAATGGTTTGATTGTTAGATTCCTCAAATAGTTTATTGGTTTT
ATTTTCGAAGATCATCTTGACAAGGAAATCTCGGCTTACAAAGAGAAAGAAAAGCTTTTA
GCAAGAATTATAGCATCTGATTTCGACCAAAAGCAAATCAATTTATCAGTTAAAAAAGCT
CATATTGACTTAAAGCCCTATGAAGATAATTCAATCGTTACTGGTGATGTTCTCACTGAT
GGCTTCGTAGTTACTAAAGCTTTATACGGTGGCTCTTATTTCGTTAAGCCAAATAATTCT
AATATTTAATAATCATTCTTGCACAAGGCTCACATTGAAAAAGAAGAATTGAAAGAAGGT
TAAACCTACACTGATGCAATTAAAATCAAAGAAATTAATTATTTCGAATAAATTCCCATT
ATCACTGCTAAGGGAGAATTAGTTAAGCGTGTAACAAACTGGAATGATCTAAGACCAGGC
ATGCAACTTAGTGCAAAAATCGATAAGATCATTTAAGGAGCCAATAATTAATATAAATTG
AAAGTAGCAGTTAATGATAAAATGATAGGTTTAGTTGATTTTTACAATACTGCTGATATT
CCCAAAGCTGGTCCTGTTCCTAAAAACTTGAAGGAAGGTAGAAAAATTAAGGTTAGAATT
ATGAGTGTTAATCCTTCTGATAAGACTCTTCGTTTTACCATCAAGCCTGCATTATTGAAT
GAAGAAGATGACAAAATTCTTAAAAATATCTCCAATGCCCAAGTCGGCGACTCCTACTTA
GGTTTTATCTCCAGAAAAACTGAATATGGCTATATAGTTTAATTCTTTGGCGATGTCATT
GGTTTACTCACTTTTAAGGACATAGAAGAAATTAACGGACACAGTCGTGATGAATACAAA
GTTGGTTAAGTTATTAGAGTTTATATTGCCTTTGTTAATGCTGAATAAGGAAAGATTGGT
CTCTCCATTTCTGAAAAAGGAGTTTCTCAATTATAAAAATAAAAGCTTTCATAGAACACC
TCAAGAAAGACTTTGTTCGAATTCTAAGCAATCAATGAAAACGTTGAAAATATCTCTCAC
AATGTTGGAGATGTTTTGGAATATATTGTCGAAAACAATCAAGCTCTCTAAGACGTTTTG
ACTCTTTACCACAAGGAACACAGAGCCATTATTGCTATTGAGCACTTATCAGACTTTAGA
AATCACTACTAATCTCTCAACTAATACTACAGAACTCTTCCTAACAAGGGTAATCAAGTA
ACAATTAAATGTAAAATTATTCATATCATGCCAAACAAGAATGTTATTGTCTCTGCTAAG
CCTAGCATTTTGAGCAATATGAATCCCAATTCTTTAGAAAGTGTTAAGGCTAATAATATC
TACACTGCTTACATTGATAGAGGTGCCCGTAAAGGTGTCTTGGTTAAGTTCAATGAAAGA
GTTAAATTTTTCATTGGTAAGGAAAATTTGGATGAACACGCTGCATTCCAAACTTACGAC
AGTGTTTTAGTTTTTGTTAAAAATGTTGAAGGTGATAAAATCACTGCAAGCTTATAAAAT
GAAGCTGTTTTCAAGAAACAAGCCCACATTAACAGCTAATTCAACAGATTCATTGAATAT
TTTAATGACGAATACATGTTAAACAAGAAATTCACTTAAGGTGAACACAAAAAAACATGG
AATAAATATAGAGTTGGTAACTACGTAAACACTACCATTGAACTTGTCAAAGAATTCGGT
ATTGTAGTTAAAGTTAACGATTCACCTTTAACAGGTTTAATTATGAACGAGCACGTTGCT
AACACTAGAAGCACTTTGGCTGAAGGTCAAACTCTCCTTTGCAGAATCACAGACATTGAT
TTCGAAAAGCAAATGGTTGATGTTATTCCTAGTCCCATTGATGATAATACCAAGTTGACC
ACTCTCTTACAAAGCAACAACTTCAACTTAGACAAATTCCTTGAATTAGAAAATAACGAA
ACTATTGATGCAACTGTCATTTGCTAGAAGGGCGAATACATTATTTGCTAGATCACCAAG
GCTCCTAAAGTTTTTTGCTACGTTAACATGACTAACTTTAATAATCTTGAACACGAAGAA
ATGCTTTTCGGATAAAAAATCAAAAACCTTAAGTGTGTTAACAAAGAAATATTACAAAAG
ACTCATAAGAATGCTTAATCTACCAATATGGCTTTAAGAAGCAACTATATTCCTTTATTC
GAATAATAGGTTAACTAACAAAATAAAGGAACAGCTATCGAAGAAAAGAGCGGAATTACT
CTTAAACCTGGTATTAAGGTTGTTGGTAAAGTCCTTAAGACTGTTGGCTTCAATGTCTTT
GTTTAACTCAAGGGTAAACTTTATGGAAAATTACATAAATCATAATGCCAAGATGCTGAA
TAATTTGCTTCTTTTAAGGAAGGCTAACAAATTGATTGCAAGATTCTCTATCTTAAGAAA
GACAAATCTCTATAGATTGATTTAACTACTAAGTAGGCTCACATGAATAGCACATTACTT
GAAGAAAGTGAAGTTTTATCTATGAGCATTGATAATTTCAGAGAAAACTGTGTTGGTTAA
ATTCACCGTGGTGTTGTAAAAAGCACAGATCCTTCTTCAATTCACCCTGTTTACATTGAA
TTATCCAACTATCATCATGGTTACTTCAGCGCTTTCGATCTCGACGCTGAAGATCTTAAC
TAAATTAAGAAGAAATACAAAAAGGGCTCCATAGTTGAATGCAGAATTGTTTCTTTATCT
TCATCCAAAGAAAACGATCTCAAGCACATCTAACTTTCTCCTAAGTTATTGTCTGCTGAT
GAATCTGCTGAAAAGAAAGACTCTATCAAGGTTGGAGATCTCGTCACAGCTAAGATTGTT
AAGAAAAACAACAATGGTTTCCGTGTTCAAATCAGCGATAATCTCTTCGGAAATGTTGAT
ATTACTGAAATCTGCGATGAATGGATTGCTAATGCCTCTTCTTCCATTCAAATAAACTCT
TTTGTTAAGGCTAGAGTTATTGCTGAAGAAGGTGATCACAAATATCTTTCTCTCCGTTCT
TCAGTTACTAATGAATAAAACTGGAAAAACTCTTTAGGTCCCAATGGAACCACTATTAAC
TACAAAAAGTACTTCTCCGATAGCGAAAAGATTGGAGATCTCAGAAATAGAATTATTAAA
CTCGGTCCTGGTTCTATTAAGGTCGGTATGGTATTTGTTGGTTACATCAACTAAACTAAC
GATAAGGGTTGCTTTATTAAGATTGGTTAAGACACTGTTGTTAGAGCAAGCTTGAACGAA
TTAAGCGATGAACATATTGCTAAGCCTTAAACTCATTTCTACCAAAATAAGCTTGTTGTT
GGTAGAATCATTTAAATTAAGGAAGATGGTAAAATTGAAGCTTCTCTTCGTGAATCTGTT
ATTAAATACGGTTACTCCATGGATGACAGCAAATTATAAGTTGGTGCTACCGTCTATGGT
ACTGTCGTTGGTCACTACTAAGGCAGAGCTTCCGTTTCAATAAGAGGATGCAAGTTTAGA
GCTTCTCTTGATAAGGATGACACTGATTTCACCGATGAAGAAAAAATGGGTTATGTTGAA
AAACTTCTCCCTATTGGTTCTGCAGTGAAGGCTAAGGTTATTAAGTACGAAAAGGAGCCT
AAGGTCAAGATTATTTTGAGCACTGAAAAGCTCGTCTTTGATAAGTACAGCAACGTTGAA
GAAGCTGAAAAGGAAGAAAGTGAATAAAGCCATTTGGATCTCCTTATCAAATCCGTAGAT
GAAATCAATGTCACTGCAAAGGTTGCTGATGAAAAGACAACTGAAATTAAAATTACTAAA
AACTATGCTCTTAACCAAGAAAATAAAACTGAATAAGATGAAGAAAAAATGGAAGAGGAA
GACGAAGAATAGGAAGATGATGAAGACAACAAATCCGATTTAGATGAAGATGAAATATAA
AATCTTATTGCTAATTAAGGAGTAGAATTCGAAGGATTTGAAGGTAACGAAGAAGCTGGT
GATGATGATGAAGGTGAAGATGATGAAAGCATTTTGAGTGAACAAAGTTTACTCGATGAA
GAATTCGGTGAAGAAGACATCATCTCTAACAAGAAGAAATCAAGAAGATAAAAAGAAATC
ATCAAGCGTAAAAAAGAAGAAGAAATCAGAGAATAAGAAAAGAAATTGATTGATGAAAAC
GCTTAACCCGAAAACAGAGATGACTACGAAAAACTCATCTTGAAGAATCCTAATAGTTCT
TATGTTTGGATTTAATTCATTGCTTTCGTCATTGAAAAGGAAGGAATTCAAGCTGCTCGT
GAAGTCACCGAAAGAGCTCTTAGAGTTATTAATTTCAAGAATGAAAATGAAAAATTAAAC
ATTTGGACTGCTTATCTCAACTTAGAACACAACTTTGGTGAAGAAAAGGCTCTAGTTAAG
GTTTTCGAAAGAGCTAAAGCTTCTTGCAAGCCCAAAGACGTCTACTTCAAGTTACTTGAA
ATCTACAGAAGAGATTCTAGCAAATACGAATTACTCTTCCAACTTTCAAAGAATATGGTC
ACTAAATTTAAACACTCAAGCAAGTGCTGGATTGAACACGTTAAAAATGTCATTTTATAC
AGAGACAGCATGATTGAAAAGAAACAAGAAAATAAACTCAACTAAAGCCACGATCCCAAA
GAAGTTTTAAAGAGAGCTTTGATTTGCTTAAAGAAGAAGAAACACATTATTGTCCTTTCT
TAATATGCTAAAATCTAATATCAAAGCAAGCAAGCTGAAACAGGACGTACCACTTTTGAA
GCTGTTGTAGCCAACTATCCTAAGAGAACTGATATCTGGAATGTTTACATCGATATGGAA
ATGAAGTATGGTACCTTAGAAAGCGCTAGAAACTTATTTGAACGTGTCATAACTATGTAA
TTCAAGCCCAGATAAATGAAATTCTTCTTCAAGAAATATCTCCAATTCGAAGCTACCAAA
GGAACTACTGAAAGAGTTGAAGAAGTTAAATAAAAGGCTGCTGAATACGTCCAATCTCTT
ATTGGTTAAGATGAAGATAACGAACAAGAAGAAGAATAAAATGAAATGGATGTTGAAGAA
TAAAATGGTGATGAAGAAATTGAAAATATAGATGATGACATCGAAGACGAAGACGATGAA
TGA


>TTHERM_00961910(protein)
MAPINNKSQQKGKPHPAKGGRQNQQDKPKRKVPAWENKFKDEIVDYFDGAQDADGEQMFN
KMPILKENNRVMKPSKKAKNLKQKSDIINSDDEFERMMMGGQSKKLKSADDDIFGGESGL
FTAGEQSFSNFFIQNKYALLQLEKVPVLRYSPGTQVLTAVSEYGSNGQYMVVNLSRNKKA
FVTVADATEASKEENDLRIYDQGEYLIGEIVPSIKEGNMNVSIKTSKVNSGLQISDIHLN
MILPGLVSSKEDHGAKIEFNGGEKYFGFLSKDEANNFEDLEEGRVYMFRVIKKEEKKRLV
HLSQKVSDQEGKFVVSGEVDIEDGADLHHLAKPGNLVNAVILKVLNNGLIVRFLKQFIGF
IFEDHLDKEISAYKEKEKLLARIIASDFDQKQINLSVKKAHIDLKPYEDNSIVTGDVLTD
GFVVTKALYGGSYFVKPNNSNIQQSFLHKAHIEKEELKEGQTYTDAIKIKEINYFEQIPI
ITAKGELVKRVTNWNDLRPGMQLSAKIDKIIQGANNQYKLKVAVNDKMIGLVDFYNTADI
PKAGPVPKNLKEGRKIKVRIMSVNPSDKTLRFTIKPALLNEEDDKILKNISNAQVGDSYL
GFISRKTEYGYIVQFFGDVIGLLTFKDIEEINGHSRDEYKVGQVIRVYIAFVNAEQGKIG
LSISEKGVSQLQKQKLSQNTSRKTLFEFQAINENVENISHNVGDVLEYIVENNQALQDVL
TLYHKEHRAIIAIEHLSDFRNHYQSLNQYYRTLPNKGNQVTIKCKIIHIMPNKNVIVSAK
PSILSNMNPNSLESVKANNIYTAYIDRGARKGVLVKFNERVKFFIGKENLDEHAAFQTYD
SVLVFVKNVEGDKITASLQNEAVFKKQAHINSQFNRFIEYFNDEYMLNKKFTQGEHKKTW
NKYRVGNYVNTTIELVKEFGIVVKVNDSPLTGLIMNEHVANTRSTLAEGQTLLCRITDID
FEKQMVDVIPSPIDDNTKLTTLLQSNNFNLDKFLELENNETIDATVICQKGEYIICQITK
APKVFCYVNMTNFNNLEHEEMLFGQKIKNLKCVNKEILQKTHKNAQSTNMALRSNYIPLF
EQQVNQQNKGTAIEEKSGITLKPGIKVVGKVLKTVGFNVFVQLKGKLYGKLHKSQCQDAE
QFASFKEGQQIDCKILYLKKDKSLQIDLTTKQAHMNSTLLEESEVLSMSIDNFRENCVGQ
IHRGVVKSTDPSSIHPVYIELSNYHHGYFSAFDLDAEDLNQIKKKYKKGSIVECRIVSLS
SSKENDLKHIQLSPKLLSADESAEKKDSIKVGDLVTAKIVKKNNNGFRVQISDNLFGNVD
ITEICDEWIANASSSIQINSFVKARVIAEEGDHKYLSLRSSVTNEQNWKNSLGPNGTTIN
YKKYFSDSEKIGDLRNRIIKLGPGSIKVGMVFVGYINQTNDKGCFIKIGQDTVVRASLNE
LSDEHIAKPQTHFYQNKLVVGRIIQIKEDGKIEASLRESVIKYGYSMDDSKLQVGATVYG
TVVGHYQGRASVSIRGCKFRASLDKDDTDFTDEEKMGYVEKLLPIGSAVKAKVIKYEKEP
KVKIILSTEKLVFDKYSNVEEAEKEESEQSHLDLLIKSVDEINVTAKVADEKTTEIKITK
NYALNQENKTEQDEEKMEEEDEEQEDDEDNKSDLDEDEIQNLIANQGVEFEGFEGNEEAG
DDDEGEDDESILSEQSLLDEEFGEEDIISNKKKSRRQKEIIKRKKEEEIREQEKKLIDEN
AQPENRDDYEKLILKNPNSSYVWIQFIAFVIEKEGIQAAREVTERALRVINFKNENEKLN
IWTAYLNLEHNFGEEKALVKVFERAKASCKPKDVYFKLLEIYRRDSSKYELLFQLSKNMV
TKFKHSSKCWIEHVKNVILYRDSMIEKKQENKLNQSHDPKEVLKRALICLKKKKHIIVLS
QYAKIQYQSKQAETGRTTFEAVVANYPKRTDIWNVYIDMEMKYGTLESARNLFERVITMQ
FKPRQMKFFFKKYLQFEATKGTTERVEEVKQKAAEYVQSLIGQDEDNEQEEEQNEMDVEE
QNGDEEIENIDDDIEDEDDE


>TTHERM_00961910(gene)
ATGGCTCCTATAAATAATAAATCATAATAAAAGGGTAAACCACACCCAGCTAAGGGCGGT
AGATAAAATCAATAAGACAAGCCCAAAAGAAAAGTTCCAGCTTGGGAAAACAAATTTAAA
GATGAAATAGTAGATTATTTTGATGGTGCTCAAGACGCAGATGGTGAGCAAATGTTTAAT
AAAATGCCCATTCTTAAGGAAAACAACAGGGTTATGAAGCCATCCAAGAAAGCAAAAAAT
TTAAAATAAAAGAGTGACATTATAAATTCAGATGACGAGTTTGAAAGAATGATGATGGGA
GGTTAGTCTAAAAAATTAAAATCTGCTGACGACGACATTTTCGGAGGAGAATCAGGCTTA
TTCACTGCTGGTGAATAGTCTTTCAGCAATTTCTTTATTTAAAATAAATATGCTTTACTT
CAACTTGAAAAAGTCCCAGTCCTTGTAAAAATTTCTTTCTTTTACCATTTTAATTCTAAC
ATTTTTCAAAATCAAAACTTACTCATTTCTACTTGTTTAAATAATAGAGATATTCTCCTG
GAACTTAAGTTTTAACTGCTGTCAGCGAATATGGTTCAAACGGACAATATATGGTTGTTA
ACTTATCAAGAAATAAAAAGGCTTTCGTCACTGTTGCTGATGCTACAGAAGCAGTATGTT
TTTATCTTATTTTTATGATAATTTTTTTAAAAAAATCGAATAGTTCTTGAATTTGCTGCA
TCTTCTACTTATTTGCAAAACAAAATAGGTCATGATGAATAACTATCATTTATCTATTAT
TGAATCAAAAATTTATATAAAATGCAACAGATTGAAATAGCTATTTCGTTTATTTAAAGA
TTTTAATATGAACAAAAATTTAAAGATTATACTTTTGTTCAATATTTAATTTAAATTTAT
TCATATAAAATTAGAGCAAGGAAGAAAATGATTTAAGAATTTATGATTAAGGTGAATATT
TGATTGGTGAAATAGTTCCTAGCATTAAGGAAGGAAACATGAATGTTTCAATTAAGACTT
CTAAGGTCAATAGCGGACTTTAAATTAGCGATATTCATTTAAATATGATTTTACCAGGTC
TTGTTTCAAGCAAAGAAGACCACGGTGCCAAGATTGAATTCAATGGAGGCGAGAAGTACT
TTGGCTTTTTATCAAAAGATGAAGCTAATAACTTTGAGGATTTAGAAGAAGGTAGAGTTT
ATATGTTCAGAGTTATTAAGAAAGAAGAAAAGAAGAGATTAGTTCATTTAAGTCAAAAGG
TTTCTGATTAGGAAGGAAAGTTTGTTGTTAGCGGCGAAGTTGACATTGAAGATGGTGCCG
ATTTACATCACTTAGCTAAGCCTGGTAACCTTGTCAATGCTGTCATTTTAAAGGTTTTGA
ACAATGGTTTGATTGTTAGATTCCTCAAATAGTTTATTGGTTTTATTTTCGAAGATCATC
TTGACAAGGAAATCTCGGCTTACAAAGAGAAAGAAAAGCTTTTAGCAAGAATTATAGCAT
CTGATTTCGACCAAAAGCAAATCAATTTATCAGTTAAAAAAGCTCATATTGACTTAAAGC
CCTATGAAGATAATTCAATCGTTACTGGTGATGTTCTCACTGATGGCTTCGTAGTTACTA
AAGCTTTATACGGTGGCTCTTATTTCGTTAAGCCAAATAATTCTAATATTTAATAATCAT
TCTTGCACAAGGCTCACATTGAAAAAGTAATTTCTATTTTTTGGAAAAAATTTTAATAAA
TATTTTTCTTAACGAGATTTTTCATAAATAAGCTTTTTTTTTTACAATAAATTAGGAAGA
ATTGAAAGAAGGTTAAACCTACACTGATGCAATTAAAATCAAAGAAATTAATTATTTCGA
ATAAATTCCCATTATCACTGCTAAGGGAGAATTAGTTAAGCGTGTAACAAACTGGAATGA
TCTAAGACCAGGCATGCAACTTAGTGCAAAAATCGATAAGATCATTTAAGGAGCCAATAA
TTAATATAAATTGAAAGTAGCAGTTAATGATAAAATGATAGGTTTAGTTGATTTTTACAA
TACTGCTGATATTCCCAAAGCTGGTCCTGTTCCTAAAAACTTGAAGGAAGGTAGAAAAAT
TAAGGTTAGAATTATGAGTGTTAATCCTTCTGATAAGACTCTTCGTTTTACCATCAAGCC
TGCATTATTGAATGAAGAAGATGACAAAATTCTTAAAAATATCTCCAATGCCCAAGTCGG
CGACTCCTACTTAGGTTTTATCTCCAGAAAAACTGAATATGGCTATATAGTTTAATTCTT
TGGCGATGTCATTGGTTTACTCACTTTTAAGGACATAGAAGAAATTAACGGACACAGTCG
TGATGAATACAAAGTTGGTTAAGTTATTAGAGTTTATATTGCCTTTGTTAATGCTGAATA
AGGAAAGATTGGTCTCTCCATTTCTGAAAAAGGAGTTTCTCAATTATAAAAATAAAAGCT
TTCATAGAACACCTCAAGAAAGACTTTGTTCGAATTCTAAGCAATCAATGAAAACGTTGA
AAATATCTCTCACAATGTTGGAGATGTTTTGGAATATATTGTCGAAAACAATCAAGCTCT
CTAAGACGTTTTGACTCTTTACCACAAGGAACACAGAGCCATTATTGCTATTGAGCACTT
ATCAGACTTTAGAAATCACTACTAATCTCTCAACTAATACTACAGAACTCTTCCTAACAA
GGTAAATAAATTTAAGATTATAAAAGCTCTTATTAATTATATCAGAAAAAATTTAGCATT
AATTTAACCTAGTTCAAAGCAAATAACTTTTAGCATCTAAAATAATGCGTTTAAATTACT
TAAAAAATAAAAAATCTTGGAAATTTTAGAAATTTCTTATTTAAGAAATTCACTGAAAAT
GAAAAGATTTTTAAATTTTTATTAAAAATAAATAATTTTAATTTAAAGTTTTTTATGTTT
AATGTTTTTAAAATTAATAAAATTAGGGTAATCAAGTAACAATTAAATGTAAAATTATTC
ATATCATGCCAAACAAGAATGTTATTGTCTCTGCTAAGCCTAGCATTTTGAGCAATATGA
ATCCCAATTCTTTAGAAAGTGTTAAGGCTAATAATATCTACACTGCTTACATTGATAGAG
GTGCCCGTAAAGGTGTCTTGGTTAAGTTCAATGAAAGAGTTAAATTTTTCATTGGTAAGG
AAAATTTGGATGAACACGCTGCATTCCAAACTTACGACAGTGTTTTAGTTTTTGTTAAAA
ATGTTGAAGGTGATAAAATCACTGCAAGCTTATAAAATGAAGCTGTTTTCAAGAAACAAG
CCCACATTAACAGCTAATTCAACAGATTCATTGAATATTTTAATGACGAATACATGTTAA
ACAAGAAATTCACTTAAGGTGAACACAAAAAAACATGGAATAAATATAGAGTTGGTAACT
ACGTAAACACTACCATTGAACTTGTCAAAGAATTCGGTATTGTAGTTAAAGTTAACGATT
CACCTTTAACAGGTTTAATTATGAACGAGCACGTTGCTAACACTAGAAGCACTTTGGCTG
AAGGTCAAACTCTCCTTTGCAGAATCACAGACATTGATTTCGAAAAGCAAATGGTTGATG
TTATTCCTAGTCCCATTGATGATAATACCAAGTTGACCACTCTCTTACAAAGCAACAACT
TCAACTTAGACAAATTCCTTGAATTAGAAGTATTATTATTTCTTATTATAAATCCTTAAA
CAACTTTATTCAAAATTTTTTTAGCTTTCCTTCAATATTCAATAGTTCATTATTGATATT
TAATTTTTAAAAATTTTTAATTAATAGAATAACGAAACTATTGATGCAACTGTCATTTGC
TAGAAGGGCGAATACATTATTTGCTAGATCACCAAGGCTCCTAAAGTTTTTTGCTACGTT
AACATGACTAACTTTAATAATCTTGAACACGAAGAAATGCTTTTCGGATAAAAAATCAAA
AACCTTAAGTGTGTTAACAAAGAAATATTACAAAAGACTCATAAGAATGCTTAATCTACC
AATATGGCTTTAAGAAGCAACTATATTCCTTTATTCGAATAATAGGTTAACTAACAAAAT
AAAGGAACAGCTATCGAAGAAAAGAGCGGAATTACTCTTAAACCTGGTATTAAGGTTGTT
GGTAAAGTCCTTAAGACTGTTGGCTTCAATGTCTTTGTTTAACTCAAGGGTAAACTTTAT
GGAAAATTACATAAATCATAATGCCAAGATGCTGAATAATTTGCTTCTTTTAAGGAAGGC
TAACAAATTGATTGCAAGATTCTCTATCTTAAGAAAGACAAATCTCTATAGATTGATTTA
ACTACTAAGTAGGCTCACATGAATAGCACATTACTTGAAGAAAGTGAAGTTTTATCTATG
AGCATTGATAATTTCAGAGAAAACTGTGTTGGTTAAATTCACCGTGGTGTTGTAAAAAGC
ACAGATCCTTCTTCAATTCACCCTGTTTACATTGAATTATCCAACTATCATCATGGTTAC
TTCAGCGCTTTCGATCTCGACGCTGAAGATCTTAACTAAATTAAGAAGAAATACAAAAAG
GGCTCCATAGTTGAATGCAGAATTGTTTCTTTATCTTCATCCAAAGAAAACGATCTCAAG
CACATCTAACTTTCTCCTAAGTTATTGTCTGCTGATGAATCTGCTGAAAAGAAAGACTCT
ATCAAGGTTGGAGATCTCGTCACAGCTAAGATTGTTAAGAAAAACAACAATGGTTTCCGT
GTTCAAATCAGCGATAATCTCTTCGGAAATGTTGATATTACTGAAATCTGCGATGAATGG
ATTGCTAATGCCTCTTCTTCCATTCAAATAAACTCTTTTGTTAAGGCTAGAGTTATTGCT
GAAGAAGGTGATCACAAATATCTTTCTCTCCGTTCTTCAGTTACTAATGAATAAAACTGG
AAAAACTCTTTAGGTCCCAATGGAACCACTATTAACTACAAAAAGTACTTCTCCGATAGC
GAAAAGATTGGAGATCTCAGAAATAGAATTATTAAACTCGGTCCTGGTTCTATTAAGGTC
GGTATGGTATTTGTTGGTTACATCAACTAAACTAACGATAAGGGTTGCTTTATTAAGATT
GGTTAAGACACTGTTGTTAGAGCAAGCTTGAACGAATTAAGCGATGAACATATTGCTAAG
CCTTAAACTCATTTCTACCAAAATAAGCTTGTTGTTGGTAGAATCATTTAAATTAAGGAA
GATGGTAAAATTGAAGCTTCTCTTCGTGAATCTGTTATTAAATACGGTTACTCCATGGAT
GACAGCAAATTATAAGTTGGTGCTACCGTCTATGGTACTGTCGTTGGTCACTACTAAGGC
AGAGCTTCCGTTTCAATAAGAGGATGCAAGTTTAGAGCTTCTCTTGATAAGGATGACACT
GATTTGTAATATTTTATTTAAAAAATCATTATTTTTATTAATTTTTAATTTTAACGAATA
GCACCGATGAAGAAAAAATGGGTTATGTTGAAAAACTTCTCCCTATTGGTTCTGCAGTGA
AGGCTAAGGTTATTAAGTACGAAAAGGAGCCTAAGGTCAAGATTATTTTGAGCACTGAAA
AGCTCGTCTTTGATAAGTACAGCAACGTTGAAGAAGCTGAAAAGGAAGAAAGTGAATAAA
GCCATTTGGATCTCCTTATCAAATCCGTAGATGAAATCAATGTCACTGCAAAGGTTGCTG
ATGAAAAGACAACTGAAATTAAAATTACTAAAAACTATGCTCTTAACCAAGAAAATAAAA
CTGAATAAGATGAAGAAAAAATGGAAGAGGAAGACGAAGAATAGGAAGATGATGAAGACA
ACAAATCCGATTTAGATGAAGATGAAATATAAAATCTTATTGCTAATTAAGGAGTAGAAT
TCGAAGGATTTGAAGGTAACGAAGAAGCTGGTGATGATGATGAAGGTGAAGATGATGAAA
GCATTTTGAGTGAACAAAGTTTACTCGATGAAGAATTCGGTGAAGAAGACATCATCTCTA
ACAAGAAGAAATCAAGAAGATAAAAAGAAATCATCAAGCGTAAAAAAGAAGAAGAAATCA
GAGAATAAGAAAAGAAATTGATTGATGAAAACGCTTAACCCGAAAACAGAGATGACTACG
AAAAACTCATCTTGAAGAATCCTAATAGTTCTTATGTTTGGATTTAATTCATTGCTTTCG
TCATTGAAAAGGAAGGAATTCAAGCTGCTCGTGAAGTCACCGAAAGAGCTCTTAGAGTTA
TTAATTTCAAGAATGAAAATGAAAAATTAAACATTTGGACTGCTTATCTCAACTTAGAAC
ACAACTTTGGTGAAGAAAAGGCTCTAGTTAAGGTTTTCGAAAGAGCTAAAGCTTCTTGCA
AGCCCAAAGACGTCTACTTCAAGTTACTTGAAATCTACAGAAGAGATTCTAGCAAATACG
AATTACTCTTCCAACTTTCAAAGGTAAAATACAAAAATTAATTTATTTGAATTAAATTTA
ATATATAAAAAAAAAGAATATGGTCACTAAATTTAAACACTCAAGCAAGTGCTGGATTGA
ACACGTTAAAAATGTCATTTTATACAGAGACAGCATGATTGAAAAGAAACAAGAAAATAA
ACTCAACTAAAGCCACGATCCCAAAGAAGTTTTAAAGAGAGCTTTGATTTGCTTAAAGAA
GAAGAAACACATTATTGTCCTTTCTTAATATGCTAAAATCTAATATCAAAGCAAGCAAGC
TGAAACAGGACGTACCACTTTTGAAGCTGTTGTAGCCAACTATCCTAAGAGGTAATTATA
AAAATTAACTAACATATTCTTAATAAACTAATTAATTGTTTTTATTAATACAGAACTGAT
ATCTGGAATGTTTACATCGATATGGAAATGAAGTATGGTACCTTAGAAAGCGCTAGAAAC
TTATTTGAACGTGTCATAACTATGTAATTCAAGCCCAGATAAATGAAATTCTTCTTCAAG
AAATATCTCCAATTCGAAGCTACCAAAGGAACTACTGAAAGAGTTGAAGAAGTTAAATAA
AAGGCTGCTGAATACGTCCAATCTCTTATTGGTTAAGATGAAGATAACGAACAAGAAGAA
GAATAAAATGAAATGGATGTTGAAGAATAAAATGGTGATGAAGAAATTGAAAATATAGAT
GATGACATCGAAGACGAAGACGATGAATGA