Identifiers and Description

Gene Model Identifier

TTHERM_00463140

Standard Name

RRP45 (exosome component RRP45)

Aliases

PreTt25766 | 54.m00222 | 3823.m01134

Description

exosome component RRP45

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00463140

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_10735.19.997093137033517e-262hypothetical protein (364 aa)
DictyBaseDDB_G02711006.000608367221491e-63DDB_G0271100 on chromosome: 2
position 47597 to 49269
OxytrichaContig12411.0.g656.001950283815408e-483 exoribonuclease family, doma
in 1
SGDYDR280W8.003782782428492e-46RRP45 Exosome non-catalytic co
re component; involved in 3-5
RNA processing and degradation
in both the nucleus and the c
ytoplasm; has similarity to E.
coli RNase PH and to human hR
rp45p (PM/SCL-75, EXOSC9)
WormBaseWBGene000181545.999907735769095e-44locus:exos-9 status:Confirme
d UniProt:Q20128 protein_i
d:CCD70741.1
Stentor CoeruleusSteCoe_97801.9287498479639178e-22

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00463140(coding)
ATGTAGGTATTGAGTTAAAATGAGAGCGATTTTGTTCTCTCAGGCTTGGAAAATGAGATT
AGATTAGATGGAAGAAAGTTGATGGATAGCAGAAACATTAAGGTTATTTTTGGAAATAAC
GTAGGAGAAATAGAAGTTTTAATTGGAGACACTCATATAATTACAAAAACAACTGCTGAA
ATCATTTAGCCAAAATAAGAAAAGCCTAATGAAGGCTCTCTTAAATTTAATGTTGATTTA
TCATCTATGCAAGATGAGCAACAACCAAACAATGTTAACATTAAAAAATATTCAAATGAA
ATCTAAAAATTGTTAGAAAAAATAATCAAGGGATCAAAAGCAATCGATATGGAAAGCTTG
TGTATAGTAACAAATAAGAGAGTATGGTCAATTAACGTAGATAGTTCGGTAGTTTCAAAC
GGTGGTAACCTAATTGATGCTATTTACTTATCTGTAATTATTAGTTTACTGCATTTCAGA
AAGCCTTATGTCTCTGTAGAATAGCAATCAAACATTAAAATTCACACTGAAAAAAATCCT
TAACCACTATCTATTCATCATATTCCTATTCCATTTACATTTGCTTTCTTCAAAAAGTCA
ACACTTTTAGTTTCTGATCCACTAGTACTTGAAGAGCAAATCATGGAAGGAAGACTAACT
ATTTCAGTTAATATTTATAATGATGTGTGCAATATTCATAAGCCTGGTGGTGCACCAATC
AAATTAGAATTAATTAATAAGCTTGTTGAAGTTTGCTTGAATAAAATAAAATAAATGACA
GATTTTGTGAGACAAATACTGAAAGAGTGTAATAAGCATAGTATTAACTAAATAAAGGAA
GAAAGCAAAATCATTACATTAAACTTCCCCTAAATAGTTAGTGCATCTCAAACATCTAAT
TAAATTCCATCAAACAAAATGGAGGAAGAGGAAGAGTAATATAAAGTTAGTAAAGAAGAA
ATTAAAAACTTGTTGGAAAGTAGAAATTGA


>TTHERM_00463140(protein)
MQVLSQNESDFVLSGLENEIRLDGRKLMDSRNIKVIFGNNVGEIEVLIGDTHIITKTTAE
IIQPKQEKPNEGSLKFNVDLSSMQDEQQPNNVNIKKYSNEIQKLLEKIIKGSKAIDMESL
CIVTNKRVWSINVDSSVVSNGGNLIDAIYLSVIISLLHFRKPYVSVEQQSNIKIHTEKNP
QPLSIHHIPIPFTFAFFKKSTLLVSDPLVLEEQIMEGRLTISVNIYNDVCNIHKPGGAPI
KLELINKLVEVCLNKIKQMTDFVRQILKECNKHSINQIKEESKIITLNFPQIVSASQTSN
QIPSNKMEEEEEQYKVSKEEIKNLLESRN


>TTHERM_00463140(gene)
ATGTAGGTATTGAGTTAAAATGAGAGCGATTTTGTTCTCTCAGGCTTGGAAAATGAGATT
AGATTAGATGGAAGAAAGTTGATGGATAGCAGAAACATTAAGGTTATTTTTGGAAATAAC
GTAGGAGAAATAGAAGTTTTAATTGGAGACACTCATATAATTACAAAAACAACTGCTGAA
ATCATTTAGCCAAAATAAGAAAAGCCTAATGAAGGCTCTCTTAAATTTAATGTTGATTTA
TCATCTATGCAAGATGAGCAACAACCAAACAATGTTAACATTAAAAAATATTCAAATGAA
ATCTAAAAATTGTTAGAAAAAATAATCAAGGGATCAAAGTAAATAATTAATAAATGATTT
AATTTTTATAAAAGGAACTATTTTAAATTTTAATTGAAATAATTAGAGCAATCGATATGG
AAAGCTTGTGTATAGTAACAAATAAGAGAGTATGGTCAATTAACGTAGATAGTTCGGTAG
TTTCAAACGGTGGTAACCTAATTGATGCTATTTACTTATCTGTAATTATTAGTTTACTGC
ATTTCAGAAAGCCTTATGTCTCTGTAGAATAGCAATCAAACATTAAAATTCACACTGAAA
AAAATCCTTAACCACTATCTATTCATCATATTCCTATTCCATTTACATTTGCTTTCTTCA
AAAAGTCAACACTTTTAGTTTCTGATCCACTAGTAATAAATAAATCAATACATAATTAAT
TCTATTCTAAAAAAGTCATTGAATATTAGTTGTTATCTCAAATAAATTAAAGATATTTTT
TATATTAATTATTTATTCATTTAAATTAATATTCTATTAAGGTACTTGAAGAGCAAATCA
TGGAAGGAAGACTAACTATTTCAGTTAATATTTATAATGATGTGTGCAATATTCATAAGC
CTGGTGGTGCACCAATCAAATTAGAATTAATTAATAAGTAGATGTTTTTATTATTAAATA
TATTATAATGCTAATTATTAATATTTCGAATAGGCTTGTTGAAGTTTGCTTGAATAAAAT
AAAATAAATGACAGATTTTGTGAGACAAATACTGAAAGAGTGTAATAAGCATAGTATTAA
CTAAATAAAGGAAGAAAGCAAAATCATTACATTAAACTTCCCCTAAATAGTTAGTGCATC
TCAAACATCTAATTAAATTCCATCAAACAAAGTAATTTCTTTAAAAAATAATATTTATAT
TATAAATTAACATAAAATAAATAGATGGAGGAAGAGGAAGAGTAATATAAAGTTAGTAAA
GAAGAAATTAAAAACTTGTTGGAAAGTAGAAATTGA