Identifiers and Description

Gene Model Identifier

TTHERM_00726340

Standard Name

RRP42 (Exosome complex exonuclease RRP42)

Aliases

PreTt21899 | 117.m00151

Description

3' exoribonuclease family, domain 1 containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF01138 ) 3' exoribonuclease family, domain 1

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00726340

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_04623.14.000089512234839e-1803 exoribonuclease family, doma
in 1 containing protein (271 a
a)
OxytrichaContig18372.0.g876.001122775063233e-173 exoribonuclease family, doma
in 1
DictyBaseDDB_G02802510.0000020007268868677913DDB_G0280251 on chromosome: 3
position 3165971 to 3166945
WormBaseWBGene000092890.000008000552149328928locus:exos-7 status:Confirme
d UniProt:G5EDS8 protein_i
d:CAB07377.2
SGDYDR280W0.0002999184360822198RRP45 Exosome non-catalytic co
re component; involved in 3-5
RNA processing and degradation
in both the nucleus and the c
ytoplasm; has similarity to E.
coli RNase PH and to human hR
rp45p (PM/SCL-75, EXOSC9)

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00726340(coding)
ATGAACACAAAATCAAGCCCAGGATAAATTGAATTCATTCGCGATGGATTTAAAATAAAC
ATTAGAGGTGATGGTAGAAAGAATGATTAGAGCAGAGAGTATTTAATTTAAACAGGATAG
CTCAAACAAGCAAATGGATCAAGTTTTATTAGCTTAAATGATAACAGTGTAAATATTTAT
ACAGGAATCAAGGTAGAAATAGGTGAAACTGATAACGATGAAGGAAAAATTATCTTAAAG
ATAGAATCTGCTCAAAGAACTGAACAAAATAGAGATTAAGAAAATCATATTAATAGCGAT
AAGAACACTTTGATTTATTTAGAAGCCTTGCTAAATAAGTATCTGATTCAGAATATTTGT
AAAAAATCACTTTGCATAGTTGAAAAGAAAAAATGTTGGATTCTGAATATAGATGTTTTT
ATTTTGGAGTCAGTAGAAATAGCTTATTTAAATTTAATGGCTGCTGGTATTAATGCTGCC
CTTGAAGATTTGGTGTTACCTAAAATATCAATCACTCATAATAATTTAACAAATGAAGAC
GAAATTACTTTAATTGAAGAATAGTTTTAATCCTTTTCAATTTCAAGAGACTTTAAAATG
CCTAAAATCTTGCTTATTGGATAAATTGATAGGATTCTAGTTGGAGATCTTACTGTAGAT
GAATACTATTCAGTAGAAAATAAGTATATTGTTGTTGTTGATGTTTATGAAAACAAAATT
ATTTCAATTAAAAAAACTGGATCTGGTTTCTTACCTCCTGAAGATTATGCCAAAATAGTA
TAATTTGCTCTTTCTTCTGCCTTGAAAAAGTGA


>TTHERM_00726340(protein)
MNTKSSPGQIEFIRDGFKINIRGDGRKNDQSREYLIQTGQLKQANGSSFISLNDNSVNIY
TGIKVEIGETDNDEGKIILKIESAQRTEQNRDQENHINSDKNTLIYLEALLNKYLIQNIC
KKSLCIVEKKKCWILNIDVFILESVEIAYLNLMAAGINAALEDLVLPKISITHNNLTNED
EITLIEEQFQSFSISRDFKMPKILLIGQIDRILVGDLTVDEYYSVENKYIVVVDVYENKI
ISIKKTGSGFLPPEDYAKIVQFALSSALKK


>TTHERM_00726340(gene)
ATGAACACAAAATCAAGCCCAGGATAAATTGAATTCATTCGCGATGGATTTAAAATAAAC
ATTAGAGGTGATGGTAGAAAGAATGATTAGAGCAGAGAGTATTTAATTTAAACAGGATAG
CTCAAACAAGCAAATGGATCAAGTTTTATTAGCTTAAATGATAACAGTGTAAATATTTAT
ACAGGAATCAAGGTAGAAATAGGTGAAACTGATAACGATGAAGGAAAAATTATCTTAAAG
ATAGAATCTGCTCAAAGAACTGAACAAAATAGAGATTAAGAAAATCATATTAATAGCGAT
AAGAACACTTTGATTTATTTAGAAGCCTTGCTAAATAAGTATCTGATTCAGAATATTTGT
AAAAAATCACTTTGCATAGTTGAAAAGAAAAAATGTTGGATTCTGAATATAGATGTTTTT
ATTTTGGAGTCAGTAGAAATAGCTTATTTAAATTTAATGGCTGCTGGTATTAATGCTGCC
CTTGAAGATTTGGTGTTACCTAAAATATCAATCACTCATAATAATTTAACAAATGAAGAC
GAAATTACTTTAATTGAAGAATAGTTTTAATCCTTTTCAATTTCAAGAGACTTTAAAATG
CCTAAAATCTTGCTTATTGGATAAATTGATAGGATTCTAGTTGGAGATCTTACTGTAGAT
GAATACTATTCAGTAGAAAATAAGTATATTGTTGTTGTTGATGTTTATGAAAACAAAATT
ATTTCAATTAAAAAAACTGGATCTGGTTTCTTACCTCCTGAAGATTATGCCAAAATAGTA
TAATTTGCTCTTTCTTCTGCCTTGAAAAAGTGA