Identifiers and Description

Gene Model Identifier

TTHERM_00584730

Standard Name

RRP412 (exosome complex exonuclease RRP41-2)

Aliases

PreTt04081 | 80.m00127 | 3675.m00025

Description

exosome complex exonuclease

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF03725 ) 3' exoribonuclease family, domain 2

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10%

TetraMine Data

TTHERM_00584730

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_15234.19.997962730346853e-122hypothetical protein (1709 aa)
WormBaseWBGene000072010.0000000000008001317446409227locus:exos-4.1 Putative exos
ome complex component RRP41
status:Confirmed UniProt:Q17
533 protein_id:CAA97771.3
DictyBaseDDB_G02713960.00000000039982266684865623DDB_G0271396 on chromosome: 2
position 213822 to 214686
OxytrichaContig15304.0.g550.000000000399822666848656233 exoribonuclease family, doma
in 1
SGDYGR195W0.000000030002053728821195SKI6 Exosome non-catalytic cor
e component; involved in 3-5 R
NA processing and degradation
in both the nucleus and the cy
toplasm; has similarity to E.
coli RNase PH and to human hRr
p41p (EXOSC4)

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00584730(coding)
ATGAATATTAAAGAATAAATTACTGAAAAATAATCCCTTCTTTCTGTAAGACCTTAAAAT
TATATCTAGTTGCAACAGGGAAATTCTAGTGCAAGATGTTGCTTGCAAACATAAGATTCA
AGAATAATTTGCTCAATAATTGGACCTTATCATGGCATTAAAGTTCTTTAATAAGATTGC
GAAATTAAGTGCATTATAAATTTTCTCAATAAAAATGACTCAAACATGCATGAAGAGACA
GAGTAGGATATAATATTAAAGAGAGATCTAGTTAATATGCTTAGTGAAATTGTGAATATC
AAATAATACCCAAAAAGTATTTTGCAGCTTACTTTTGATATAATATAAGTTAATGGACCA
GTGTTCCCATATTTGGTTAACGTAGCTTGCTTTGCTCTGTCCTTAGCTGGAATCTAAATT
TTAGATATATTTTCAAGCGCCTATATGGGTTTTATAGGAAATAATTTAATTATCGATCCT
AGCGACAAAGAGTTCGCTCTTATGAATAAAAAATTATGTATAGTGTAAATGAAAAATTCC
CAAAAGATAATTTACTTGGATATGAATGGTTCTTTAGATTTTGAAGAGATTTAGAAGCTT
CTTTCACTAGGCATTAGTGGATGTAATAAAATATCTACTTTGATGAGTACGTTGTTGATA
GAGTAGAACGCAGTGTTAAGCAATTGA


>TTHERM_00584730(protein)
MNIKEQITEKQSLLSVRPQNYIQLQQGNSSARCCLQTQDSRIICSIIGPYHGIKVLQQDC
EIKCIINFLNKNDSNMHEETEQDIILKRDLVNMLSEIVNIKQYPKSILQLTFDIIQVNGP
VFPYLVNVACFALSLAGIQILDIFSSAYMGFIGNNLIIDPSDKEFALMNKKLCIVQMKNS
QKIIYLDMNGSLDFEEIQKLLSLGISGCNKISTLMSTLLIEQNAVLSN


>TTHERM_00584730(gene)
ATGAATATTAAAGAATAAATTACTGAAAAATAATCCCTTCTTTCTGTAAGACCTTAAAGT
AAAATATTATGCTAAATGAAATAGATTTTACTCTAAGCTAAATATAAAAATCAACAAAAT
ATATTTCAAAATAATTGATGTTATAACTAATTCAAACTTAAAAATAGATTATATCTAGTT
GCAACAGGGAAATTCTAGTGCAAGATGTTGCTTGCAAACATAAGATTCAAGAATAATTTG
CTCAATGTAATTTATATATTTAATGAACCAATAATTTAATTAAACTTTAAATATCATCAA
GAATTGGACCTTATCATGGCATTAAAGTTCTTTAATAAGATTGCGAAATTAAGTGCATTA
TAAATTTTCTCAATAAAAATGACTCAAACATGCATGAAGAGACAGTAATTTAATTTTTAG
ACATAAATTTTACAATATGTTATTTTAAATGTGGTTTTTTTGAATCAGTTTTATAACTAA
AATGATCAAAAATATTATTTTGTTAAATAATATTATCCATCTTCTTTATTTAATTGCTTA
TGTGAATGAGCTAACTAAAATAATAGCATTTTAAAGAATGAATTAGATTATCTTGAAAAA
TTGTATGAAACATTTATCGTCGATTGATATATTATTAATAACAAATAAATTCAAAATATA
GAAAAAAATTTAATTATTTTTGTATGCTATATTCTGTCTAAAAATACTTTGTTACAAGAT
ATTAGTCTAAAAATCAACAAATATTACTAGCTAAAATTGAAATAATCACATTTTCCTTCT
AGAAAAAAGTTAATATAAGCATAGTTTTGTTGAAAGAAGTATTTTAATTACAGTTTATTA
CACTTGCTTTTAGCAACTTGGATTTAGCTTAACTATCATTTGATCAATAACAAAAAAAAA
GAGATATTTAAAAAATTTTAGCTTCATTTACAAGTGGCCAAATTAAATTTCAAATTTTAG
AAACAATTTAATAGCATTCAATCATTTTAAAATATTTAAGAATAGTTAGCCAATTTAAAC
TGCAAATTATTGGCAATACTTATGAGGAATGTAAACTTAACTAAAAGATTAAAAGCAGTC
TATTAAATTTAATTCAATAGATATACTTTATGTTATTCAATTCCTATTTGAAAGCTCGGC
ATTTAAATACAGTCTTTATCATTTTTTTGGTTTTTCAACATTACTATTTTGCAAGTATAA
TTTTTAGTTTTTGTAATGTAGATTTAAATTCCGCGAAAAATTATATGTGTGATGCAAATT
TTTTAGAACAACTTTATTAATTTAATTTTTTTTTTACTGGTAATAGGAGTAGGATATAAT
ATTAAAGAGAGATCTAGTTAATATGCTTAGTGAAATTGTGAATATCAAATAATACCCAAA
AAGTATTTTGCAGCTTACTTTTGATATAATATAAGTTAATGGACCAGTGTTCCCATATTT
GGTTAACGTAGCTTGCTTTGCTCTGTCCTTAGCTGGAATCTAAATTTTAGATATATTTTC
AAGCGCCTATATGGTAAACCTAAATTTTAATAACCTAATTTTTAATTGTACTTTACATAG
ATCATTTTATTAAATCTTTTACTTTAATTAATAGGGTTTTATAGGAAATAATTTAATTAT
CGATCCTAGCGACAAAGAGTTCGCTCTTATGAATAAAAAATTATGTATAGTGTAAATGAA
AAATTCCCAAAAGATAATTTACTTGGATATGAATGGTTCTTTAGATTTTGAAGAGATTTA
GAAGGTAAATATTATATCTTTAAATAATTTTTAAGAAATTTCTAGGAGTTAATGATGATT
TAGTTCTCAAATACTTTTTGATTGCAATTTCAATCACAAAAAATTTCAAATACTATTTTA
ATTCCAGTAGGCTCTTTTATTGCGCATTTAATAGTATCATTTTAAATATTACGAATCATA
ATAAAAAATTATTTAAGATGCATTAATAAATCATCCGAAAAGATACTTTTTTTTTCTTTG
GCATATCTTTTAACGAATTTTTTCAGATCTAAACATAAAAGAAATAATTAATGGGTGAAA
AAAATCTATTAAAAGCTTGAATATGAAATTAACATTAAAATGTCATTAATCCTACACATG
AATCAAATTAAAATTTTTGTATTAATTAAAATTAGCTTCTTTCACTAGGCATTAGTGGAT
GTAATAAAATATCTACTTTGATGAGTACGTTGTTGATAGAGTAGAACGCAGTGTTAAGCA
ATTGA