Identifiers and Description

Gene Model Identifier

TTHERM_00691500

Standard Name

RRP41 (exosome complex exonuclease RRP41)

Aliases

PreTt02988 | 106.m00175 | 3674.m00041

Description

3' exoribonuclease family, domain 1 containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( TIGR01966 ) ribonuclease PH
  • ( PF02425 ) Paralytic/GBP/PSP peptide
  • ( TIGR02065 ) exosome complex exonuclease 1
  • ( PF01138 ) 3' exoribonuclease family, domain 1
  • ( PF03725 ) 3' exoribonuclease family, domain 2

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.6%

TetraMine Data

TTHERM_00691500

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_17594.19.99955252024689e-1653 exoribonuclease family, doma
in 1 containing protein (241 a
a)
OxytrichaContig15304.0.g552.998863950472602e-383 exoribonuclease family, doma
in 1
WormBaseWBGene000072019.99893167504554e-35locus:exos-4.1 Putative exos
ome complex component RRP41
status:Confirmed UniProt:Q17
533 protein_id:CAA97771.3
DictyBaseDDB_G02913281.0004572433669413e-23DDB_G0291328 on chromosome: 6
position 128308 to 129151
Stentor CoeruleusSteCoe_127472.1151310375910805e-19
SGDYGR195W2.99851380290819e-19SKI6 Exosome non-catalytic cor
e component; involved in 3-5 R
NA processing and degradation
in both the nucleus and the cy
toplasm; has similarity to E.
coli RNase PH and to human hRr
p41p (EXOSC4)

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00691500(protein)
MNQDFLVLQEFREDGRKKNELRKVDCILGFDQTVEGSCKLIQGLTEIVCLIKGPHNKSTR
RESEGFLNVQYNVAPFSGTDRRKISKFDKDWNEFTENLRVSFESVILTEQLGSGEIDIIV
SVIQADGSAKSSIFNAISLALMDAGIPMKDFTVSSTVISLNSEILLDATYQEQKKASAEL
IISYLPRSDQVDFMEMKSSKISQQDTKEMCKIAVDGCKQMYQILRTFVLESSVKTLLSTR


>TTHERM_00691500(coding)
ATGAATTAAGATTTTTTAGTGTTGTAAGAGTTTAGAGAAGATGGTAGAAAAAAAAATGAG
CTGCGTAAAGTAGATTGCATATTAGGATTTGATTAAACTGTTGAAGGATCTTGTAAATTG
ATTTAAGGATTGACTGAAATAGTTTGCTTGATAAAGGGACCTCATAATAAATCAACTAGA
AGAGAATCAGAAGGATTTTTAAATGTTTAATATAATGTAGCCCCATTCAGTGGAACTGAT
AGAAGAAAAATTTCCAAATTCGATAAGGATTGGAACGAATTCACTGAAAATTTAAGAGTC
AGTTTTGAAAGTGTAATTCTAACAGAGCAATTAGGTTCAGGAGAAATTGATATTATAGTT
TCAGTTATTTAAGCTGATGGTAGTGCCAAAAGCTCAATTTTTAATGCCATTTCCTTAGCT
TTAATGGATGCAGGTATTCCAATGAAGGATTTCACTGTATCTTCAACAGTAATAAGCTTA
AACAGCGAAATTTTATTAGATGCAACATACTAGGAGTAAAAAAAAGCTAGTGCAGAATTG
ATAATATCTTATTTACCAAGAAGTGATTAGGTAGATTTTATGGAAATGAAATCAAGTAAA
ATAAGTTAATAAGATACTAAAGAGATGTGTAAAATTGCGGTTGATGGTTGTAAATAAATG
TATCAAATATTAAGAACTTTCGTTTTGGAAAGCTCAGTAAAAACTCTTTTGAGCACAAGA
TGA


>TTHERM_00691500(gene)
ATGAATTAAGATTTTTTAGTGTTGTAAGAGTTTAGAGAAGATGGTAGAAAAAAAAATGAG
CTGCGTAAAGTAGATTGCATATTAGGATTTGATTAAACTGTTGAAGGATCTTGTAAATTG
ATTTAAGGATTGACTGAAATAGTTTGCTTGATAAAGGGACCTCATAATGTATTTATTAAC
ATTATTAAATTTAGTTAAATAAAAATAATTCTATGAAATACAAAAGAAATCAACTAGAAG
AGAATCAGAAGGATTTTTAAATGTTTAATATAATGTAGCCCCATTCAGTGGAACTGATAG
AAGAAAAATTTCCAAATTCGATAAGTAATAAATAGTTTAAACTGCAGATGTTTTATCATT
TATATTATATAATAATGTAGGGATTGGAACGAATTCACTGAAAATTTAAGAGTCAGTTTT
GAAAGTGTAATTCTAACAGAGCAATTAGGTTCAGGAGAAATTGATATTATAGTTTCAGTT
ATTTAAGCTGATGGTAGTGCCAAAAGCTCAATTTTTAATGCCATTTCCTTAGCTTTAATG
GATGCAGGTATGCTTTTTTAATTAATAAACTTTTCTCAAATTTTAATCGAAATATTTGCA
TTAAATAAGGTATTCCAATGAAGGATTTCACTGTATCTTCAACAGTAATAAGCTTAAACA
GCGAAATTTTATTAGGTAAATTATATTCATGAAGTTTTAAAAGTAGTAAATAAAATATAT
AAAAAAGATGCAACATACTAGGAGTAAAAAAAAGCTAGTGCAGAATTGATAATATCTTAT
TTACCAAGAAGTGATTAGGTAGATTTTATGGAAATGAAATCAAGTAAAATAAGTTAATAA
GATACTAAAGAGATGTGTAAAATTGCGGTTGATGGTTGTAAATAAATGTATCAAATATTA
AGAACTTTCGTTTTGGAAAGCTCAGTAAAAACTCTTTTGAGCACAAGATGA