Identifiers and Description

Gene Model Identifier

TTHERM_01050590

Standard Name

RRP40 (exosome component RRP40)

Aliases

PreTt27802 | 212.m00060

Description

component of the exosome exonuclease complex

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_01050590

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_01462.11.0001999920370885e-161hypothetical protein (249 aa)
DictyBaseDDB_G02767832.998577119979921e-31DDB_G0276783 on chromosome: 2
position 7291532 to 7292461
OxytrichaContig20442.0.g901.000382677035467e-28Tht1-like nuclear fusion prote
in
SGDYOL142W3.0000451088882257e-25RRP40 Exosome non-catalytic co
re component; involved in 3-5
RNA processing and degradation
in both the nucleus and the c
ytoplasm; predicted to contain
both S1 and KH RNA binding do
mains; has similarity to human
hRrp40p (EXOSC3)
WormBaseWBGene000103251.9994498063102785e-22locus:exos-3 status:Confirme
d UniProt:Q93830 protein_i
d:CAB01875.1
Stentor CoeruleusSteCoe_246470.0000000000006914400106940203

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_01050590(coding)
ATGGAAATAGAAAAATAGTAATAGCCTGCTTTGAATATAGTTTTACCAGGAGAGTAAATA
GATTTGAGCTAGCTTACAGGATAGCTTTAAATCGATGAAAAATCGTTTACATTGACCACT
GATAATTAATTATACTCAAATAAATCAGGTGTTTTAGTTGATACCTAGCTAAAAGATGGG
TCCTGTGGTTTAACAGTCAAAGCTTACGCTCAAAAATATTATGCAGAAGTTGATGATTAT
GTTATTGGAGTAATTAAGGGTAGAGTATAAGAATATTATTTGGTTGATATTGGAGCTTAA
GAAGATGCATTATTATCTTTTTATGGCTTTGAAGGTGCCACTAAAAAGAATAGACCAAAT
TTAAGAGATGGATCTTTGATATTTTGCAGAGTTACTGAAGCAAATAAATATATGAAAATT
AAAGTTGATTGTATTCATCCTAAAATTAAAAAGTAGTGGATGACTGGAGAATCATTTTTT
GGATAGTTAAAAGACGGTATGGTTTCTAATATCTCAATTGAATATGCAAGGAGTATAATA
GGATAAGGAGACTTCGTATTTAGAGCATTTAAAAAATACATTAAATCTTTTGAGACAGCA
ATAGGTTCAAACGGTAAAGTTTGGATCAAAACACTCTAACCATAAAATACAATTTTGATC
CTTAACGTGCTTAATAAATGTGAGAATATGTCTATCGAATAAATTAAAGTTTATGTTGAT
TAAATCTCTCCTTTGCTTGTAAAAGAATGA


>TTHERM_01050590(protein)
MEIEKQQQPALNIVLPGEQIDLSQLTGQLQIDEKSFTLTTDNQLYSNKSGVLVDTQLKDG
SCGLTVKAYAQKYYAEVDDYVIGVIKGRVQEYYLVDIGAQEDALLSFYGFEGATKKNRPN
LRDGSLIFCRVTEANKYMKIKVDCIHPKIKKQWMTGESFFGQLKDGMVSNISIEYARSII
GQGDFVFRAFKKYIKSFETAIGSNGKVWIKTLQPQNTILILNVLNKCENMSIEQIKVYVD
QISPLLVKE


>TTHERM_01050590(gene)
ATGGAAATAGAAAAATAGTAATAGCCTGCTTTGAATATAGTTTTACCAGGAGAGTAAATA
GATTTGAGCTAGCTTACAGGATAGCTTTAAATCGATGAAAAATCGTTTACATTGACCACT
GATAATTAATTATACTCAAATAAATCAGGTGTTTTAGTTGATACCTAGCTAAAAGATGGG
TCCTGTGGTTTAACAGTCAAAGCTTACGCTCAAAAATATTATGCAGAAGTTGATGATTAT
GTTATTGGAGTAATTAAGGGTAGAGTATAAGAATATTATTTGGTTGATATTGGAGCTTAA
GAAGATGCATTATTATCTTTTTATGGCTTTGAAGGTGCCACTAAAAAGAATAGACCAAAT
TTAAGAGATGGATCTTTGATATTTTGCAGAGTTACTGAAGCAAATAAATATATGAAAATT
AAAGTTGATTGTATTCATCCTAAAATTAAAAAGTAGTGGATGACTGGAGAATCATTTTTT
GGATAGTTAAAAGACGGTATGGTTTCTAATATCTCAATTGAATATGCAAGGAGTATAATA
GGATAAGGAGACTTCGTATTTAGAGCATTTAAAAAATACATTAAATCTTTTGAGACAGCA
ATAGGTTCAAACGGTAAAGTTTGGATCAAAACACTCTAACCATAAAATACAATTTTGATC
CTTAACGTGCTTAATAAATGTGAGAATATGTCTATCGAATAAATTAAAGTTTATGTTGAT
TAAATCTCTCCTTTGCTTGTAAAAGAATGA