Identifiers and Description

Gene Model Identifier

TTHERM_00586540

Standard Name

RRP4 (exosome complex RRP4)

Aliases

PreTt24066 | 81.m00123 | 3726.m00003

Description

Exosome complex exonuclease

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00586540

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_16912.19.997093137033517e-262hypothetical protein (310 aa)
SGDYHR069C4.001202823045957e-54RRP4 Exosome non-catalytic cor
e component; involved in 3-5 R
NA processing and degradation
in both the nucleus and the cy
toplasm; predicted to contain
RNA binding domains; has simil
arity to human hRrp4p (EXOSC2)
OxytrichaContig16332.0.g851.999534248571833e-46Exosome complex exonuclease RR
P4 N-terminal region
DictyBaseDDB_G02913102.999884853455273e-42DDB_G0291310 on chromosome: 6
position 112763 to 113905
WormBaseWBGene000222329.99893167504554e-35locus:exos-2 status:Confirme
d UniProt:Q95XD0 protein_i
d:CCD74150.1
Stentor CoeruleusSteCoe_70265.74952226429356e-19

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00586540(coding)
ATGGGCGATTTATTAAAAATTAAAGATTAAATAGACTTCAAAAAATATTTGCATGATGAT
ATGCTTGGTTTAAATATTGTATTGCCAGGTGATGTCATTAAAAAAGAAAAAGGTTTCATG
AATGGACATGGTACTTATGAAGAAAACGGAATTATTTATTCTTCAGTAATAGGAACAGTA
GTATAAACAAATAAGTTGCTTAGTGTGTCACCACTTAAGTCATATTACACTCCTTAAGTA
GGAGATATTGTTGTAGGAAGGGTTATGGAAATAGGAGACAAGAAATGGAAAATAGAAATA
GGATCTAATTAATATGCAAGTCTTCACTTGAATTCAACTTATATTCCTGAACAGAGAATT
AAAACAGATGAAGATGAGTTAAATATGAGATAAATCATGAAAGAAGGAGACTTAGCTTGT
GCAGAAATTCATTCTATTAACAAGGACAAGACAGCAAACTTGCATACTAGAAGTTTAAAA
TACGGCAAGCTTGAAAATGGATTTTTGGTGGAAGTATTTAACAAACTAGTGAAAACTTAA
ACTAACCACTTCAAAAAGTTGTAATGTGGAATCAATATTATATTTTCTCACAATGGTAAA
ATTTGGCTCAACAATATTTCTAGAGAAGGCATTATTAAAGAGTAAAAAGAAGTAGAAAAG
AAATAATATAGCTATGAAGAAAGATAGGCTCTCAGCATAATCTCAAACTTACTTAAATTA
CTTGATCAATAAAATATAAAAATCAGCACTGATTTACTTGATGAGCTTTATAATTATGTG
ATTACAAAGAAAATAGAACCATCAAATATTCTAACATAAGCAGGATCTAAGGAATTAAAG
TAGTATCTGTAATAAAAATTAGAAACATAAATTCCTAAAGAAATTAATAAATTAATGAAA
TAAGGAGACTATTTAGCTTAAGATTATTGA


>TTHERM_00586540(protein)
MGDLLKIKDQIDFKKYLHDDMLGLNIVLPGDVIKKEKGFMNGHGTYEENGIIYSSVIGTV
VQTNKLLSVSPLKSYYTPQVGDIVVGRVMEIGDKKWKIEIGSNQYASLHLNSTYIPEQRI
KTDEDELNMRQIMKEGDLACAEIHSINKDKTANLHTRSLKYGKLENGFLVEVFNKLVKTQ
TNHFKKLQCGINIIFSHNGKIWLNNISREGIIKEQKEVEKKQYSYEERQALSIISNLLKL
LDQQNIKISTDLLDELYNYVITKKIEPSNILTQAGSKELKQYLQQKLETQIPKEINKLMK
QGDYLAQDY


>TTHERM_00586540(gene)
ATGGGCGATTTATTAAAAATTAAAGATTAAATAGACTTCAAAAAATATTTGCATGATGAT
ATGCTTGGTTTAAATATTGTATTGCCAGGTGATGTCATTAAAAAAGAAAAAGGTTTCATG
AAGTAATTTCAATTCTTTAACATTTGTGTTTGCAATTATTTATTTATTGAATTGATTTTA
ATTATCTTAGTGGACATGGTACTTATGAAGAAAACGGAATTATTTATTCTTCAGTAATAG
GAACAGTAGTATAAACAAATAAGTAAAGCTTTACTTATTCATCAATTCAAATTAGCAATG
TTTTTTATTTCTTAAATAGGTTGCTTAGTGTGTCACCACTTAAGTCATATTACACTCCTT
AAGTAGGAGATATTGTTGTAGGAAGGGTTATGGAAGTAAATAAACGATTTCGTTTATAAT
AGGAATATAAAATTATAATATTTAATAGATAGGAGACAAGAAATGGAAAATAGAAATAGG
ATCTAATTAATATGCAAGTCTTCACTTGAATTCAACTTATATTCCTGAACAGGTTTATTA
TTTCCTTTCAAAAAGCATAGATTGATTTAAAACTTTAACATTTTTATAGAGAATTAAAAC
AGATGAAGATGAGTTAAATATGAGATAAATCATGAAAGAAGGAGACTTAGCTTGTGCAGA
AATTCATTGTAAATAAAATAACTCTAAAATATAAATATTAACATAATCTATATTTCAGCT
ATTAACAAGGACAAGACAGCAAACTTGCATACTAGAAGTTTAAAATACGGCAAGCTTGAA
AATGGATTTTTGGTGGAAGTATTTAACAAACTAGTGAAAACTTAAACTAACCACTTCAAA
AAGTTGTAATGTGGAATCAATATTATATTTTCTCACAATGGTAAAATTTGGCTCAACAAT
ATTTCTAGAGAAGGCATTATTAAAGAGTAAAAAGAAGTAGAAAAGAAATAATATAGCTAT
GAAGAAAGATAGGCTCTCAGCATAATCTCAAACTTACTTAAATTACTTGATCAATAAAAT
ATAAAAATCAGCACTGATTTACTTGATGAGCTTTATAATTATGTGATTACAAAGAAAATA
GAACCATCGTAAATTATTTTATAAATAAACACTTTATTTATATTTTAACTTAAAAAGAAA
TATTCTAACATAAGCAGGATCTAAGGAATTAAAGTAGTATCTGTAATAAAAATTAGAAAC
ATAAATTCCTAAAGAAATTAATAAATTAATGAAATAAGGAGACTATTTAGCTTAAGATTA
TTGA