Identifiers and Description

Gene Model Identifier

TTHERM_00760630

Standard Name

RRP12 (ribosomal RNA processing protein 12)

Aliases

PreTt18548 | 125.m00112 | 3672.m00045

Description

ribosomal RNA processing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00760630

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_19006.19.997093137033517e-262hypothetical protein (1168 aa)
OxytrichaContig11042.0.g611.000403801267624e-40NUC173 domain
SGDYPL012W4.001630327199692e-20RRP12 Protein required for exp
ort of the ribosomal subunits;
associates with the RNA compo
nents of the pre-ribosomes; ha
s a role in nuclear import in
association with Pse1p; contai
ns HEAT-repeats
DictyBaseDDB_G02807970.0000000000002999981760818895DDB_G0280797 on chromosome: 3
position 3760317 to 3764888
Stentor CoeruleusSteCoe_148270.0000000000006914400106940203

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00760630(coding)
ATGGAACAAGAGAACACATTTACCTAATTATACTCCTTCACTTAGTCTAAGGATTCTGAC
CTCTATAAGAACGCCAAGATTGTTTTAGATTCAATCAAGGAAGCTCTTTAGAAAAAAGGG
ATGTTTGAAGATAAAACTATTTCAACTGCATTATTTGCCAGTTTATTTTAACTACTCTAG
TAGGATATAAATGCTAATAACATATAAAGCGAAGAGCCTAAATTGTTACTTTTCAACTAG
CTCTTGACAAAGGTGAATATGGCTATCGTTATTAAGTTCTATGAATAGATTAGAGAAATG
ATTTTTAAAGTTTTAGAATAATAAAGCCGTACCCAATTAACTTAAAAATTTGCTATTGCT
ATCTTAGTAGAATTACTGTAAACATAATAATAAATCGATTAAAATAATGTTGCCTTAGTC
AAATTAATTGAAAATATAATTAATGAACAAGTTGCAGCTCGTAAGCAAGCATGGAAAGGC
CTAAACACCCTTCTCTCTTAAAAAATTACTTCTAAATTTATGATTGGTACTGCTGTTACT
AAATTTGTTCTTGATATCCTACAAAACAGCTAAGATGATTAAATTTGCATCATAATCACT
CAATTTTTAAGCAACTCTATTTAGAACCTTCCTATTAATAACGTTAACGATATTTCTTTT
GCATTACTTAAGAGACTCTAATTAACAACTGATTAAAATCTTGAAGTTCTCATTTACCTT
TAATTCGAAAATATAATGAAATTGAGACAACTCAGCTTTGATAACTGCGAAACACTCATT
AAGGAATTTATCGATAACCAACCTAGTTTACATTCTGATCAAAAAGTAGTTATGAGTTAT
TCATAATGTCTTATTTAAACTCTTATTTTGATGCACGAACAAAATATTCATGCTGCTAAA
AAGTATATCCCTACAGTTATTTCTGTGCTTTAGGAAATTATCCTCTCAGTCGATGTTAAG
CTTGCAACATTTGGTTAAAAGTAGATGGAAACTTTGATTATTGCAGTTATTGGTGAATAT
CTTTGGAAAAAGCATAAAACTGGTGGTTTCCTCAATGAATTTGACTTTACTGAAATCGAT
AATCTCGGAGTTGAGTCTTCTACTGCAGATAACACTTTTGAAAAGATTATTTCTATGCTC
TAGCACATGTTAAGCAACCGTTTCGATAATAGATAAATCTAAGTTCATGGAGTCCTTGGT
GTTTTCTTCCAAAAGATAGATTAAGATTGCATGACAGATATAGATGGAATAGTTAAAGAA
TTAGTCGAAAATAGAGTTAATAGACACGCTTCAAGTTTTGAAAAGTGCATGGCAAAATTA
ATTTCAAAAATTGGTGCTGGTTTGATTGTTAAAAGATTCCCTCTTCAAATAGCAGGCTTA
AATCCTTTAGCTGAAGACTTTGAAGACAAGAGTAGTTTATGGATGATTCCCATGTTTTTG
AAATACACCAAGAACCAATCTATTGAAGATTTCCTTGAACATATTGTTCCTCACATCTCT
ACAATTAAGAATGGTATGGATATTACTTCATAGAAAATGAATGCATAAGAATTAGTTATG
TTTAATGTTTTCTTATAATTATGGGAGTGCTTTAGCAGATTCCACATCGTTTCTGGTGAA
AAGGGTTTCACTGCTCTTAATTTAATTTTAGATAACTTAGATCCTGAACTCAAGGATTCT
AATCCTCACTTCGGAAGTATTCTACGTGGTTTGGAGTACAGCTTTAAGTTTATTAGTCAT
GCTAAAAATGTTCCTGCTGATACTATTGTGCGTGCATAAAAACTTATCAAATCCATGCAT
ACTCTTCTCATTCCTGGCAAACCTATTTCTAAATAAATTCTTGCCGTTATTTAATAGGCT
GCTTTTATAGCTCCTAAAGAATATCTTAATTCTGCTTTTGCTCACAACATCAAAAGACTT
GTCACCACTTCTACTGAAGAAAAAACCAGAGTAAAGCTTAACAACTCAGTCAAAACTTTT
GACATGATACTTGCTGTTTCTTAATCTATGGATTTCAAGAATGATAGATGGGACATGGCT
ATGAAATTCATTAAATGCTTCCTTGACGATTAAACTGTATTACAAAAGAAGGCTTACAAA
TTTTTAAGCAATATTGTCTCCAAAGTCCATTATACTTTCCTTCCACAAGTATCTGAAATT
CTCAAAAATAAATAAGCCACTTAAAGCTCTGCTAGACCTATCAGACTTTAAGTCATTACT
TAAATTTGGTAACTAAACAAGTTTGATTCAGAAGAATCCTAAGTAGATTAAATTGGTGAA
TTCATCTAAACTTTCCTTCCTGAACTTATTGTAGGTTTAAGAGAATCTAACATTCGCTCT
AGAAAAGCTTCCTAAGAACTCTTTAAGAAGATTGCTCAAAAAATGTTAAATTTAAATATG
TTAAATGACTTTATATCTATGATCTCTGCTGGTTTGGGAGCTTCAAGCAGTTTAATGAAG
GCTGACAGTATCGTTTCTATTGCTTATCTCCTTGAGAAATTCGGAAAAAACGTAGACACT
GCTTTCATTAAAGAAGTTAACTCGATTATTTTGCTTTTGTTAAAGGAATAAAACAAAGAA
ATATTTAAAGCTGTTTTAGTTTACTTGAAGAAATATATGAGAATTATCTCAAAGGCTGAG
TTAAAAACCGAATTACCTGATATCTTCAACAATATATTTGAATCTGAATAAGTCATTAGA
GATAAGCACAGATCACTCATCAAGTAGATTGTTTCAAGATTAATTAGGAAGTTTACTAGA
ACTGTTGTTGAAGATTATGTACCAGAAGCCCATAAGAGAATTGTTAGAGGTATCTTAAAG
GAGGAAAGATACTAAAAGAATAAGAAAATCCGTGAAAGAATTGAAAGGAAGAAGCTAGCT
GCATAAGTTAAGTATAAAGAAACTGACTTTGATGTTTAGCAACGTATGGAATCTGAAAAT
TTAGCTAAACAAAAAGAAGAAAAGAACTTGTTGCTTAAATTCGATTAGGATCAACAATAA
TTCCACTTTGTTCCCAACACTGGCTTAAAGAAATTGAAAGAAAGACTTAATGAAGAAAAT
GAAAGAAAGGAAGTTGAATATATCAAGGGTAAGATTATCGTACGTGAGGCTATTGAAGAT
ATGACTGGTAAAAAGAGAAGAAGAGAAGACAAATATGCTACATATGATTCTATCATTCAA
GAAGAAAGAGACATCAATGATAATGAAAAGACTATCACTTCAAGAAAATTAACTTAGAAA
AGAACAGATAATAAAAACAATCTTGTTCACAACATTAAAGAGTCTGGTGATACTTTCAAG
GCTAAGGGTGAAACTGGTGGTGATGTTGTTAGAAAAGGTAAACCTGATCCATATGCATTT
ATTTAATTGAATCCTAAGGCTTTAAATAAGAGACATCAAAAGAGAGCTTCTAAAGCATTC
GATGTTATTATGAATAAAAAAGAAGATGGAGCATTAAAGGGTCTTAAAACTAGTAACAAA
AAGGTGAAATAATGA


>TTHERM_00760630(protein)
MEQENTFTQLYSFTQSKDSDLYKNAKIVLDSIKEALQKKGMFEDKTISTALFASLFQLLQ
QDINANNIQSEEPKLLLFNQLLTKVNMAIVIKFYEQIREMIFKVLEQQSRTQLTQKFAIA
ILVELLQTQQQIDQNNVALVKLIENIINEQVAARKQAWKGLNTLLSQKITSKFMIGTAVT
KFVLDILQNSQDDQICIIITQFLSNSIQNLPINNVNDISFALLKRLQLTTDQNLEVLIYL
QFENIMKLRQLSFDNCETLIKEFIDNQPSLHSDQKVVMSYSQCLIQTLILMHEQNIHAAK
KYIPTVISVLQEIILSVDVKLATFGQKQMETLIIAVIGEYLWKKHKTGGFLNEFDFTEID
NLGVESSTADNTFEKIISMLQHMLSNRFDNRQIQVHGVLGVFFQKIDQDCMTDIDGIVKE
LVENRVNRHASSFEKCMAKLISKIGAGLIVKRFPLQIAGLNPLAEDFEDKSSLWMIPMFL
KYTKNQSIEDFLEHIVPHISTIKNGMDITSQKMNAQELVMFNVFLQLWECFSRFHIVSGE
KGFTALNLILDNLDPELKDSNPHFGSILRGLEYSFKFISHAKNVPADTIVRAQKLIKSMH
TLLIPGKPISKQILAVIQQAAFIAPKEYLNSAFAHNIKRLVTTSTEEKTRVKLNNSVKTF
DMILAVSQSMDFKNDRWDMAMKFIKCFLDDQTVLQKKAYKFLSNIVSKVHYTFLPQVSEI
LKNKQATQSSARPIRLQVITQIWQLNKFDSEESQVDQIGEFIQTFLPELIVGLRESNIRS
RKASQELFKKIAQKMLNLNMLNDFISMISAGLGASSSLMKADSIVSIAYLLEKFGKNVDT
AFIKEVNSIILLLLKEQNKEIFKAVLVYLKKYMRIISKAELKTELPDIFNNIFESEQVIR
DKHRSLIKQIVSRLIRKFTRTVVEDYVPEAHKRIVRGILKEERYQKNKKIRERIERKKLA
AQVKYKETDFDVQQRMESENLAKQKEEKNLLLKFDQDQQQFHFVPNTGLKKLKERLNEEN
ERKEVEYIKGKIIVREAIEDMTGKKRRREDKYATYDSIIQEERDINDNEKTITSRKLTQK
RTDNKNNLVHNIKESGDTFKAKGETGGDVVRKGKPDPYAFIQLNPKALNKRHQKRASKAF
DVIMNKKEDGALKGLKTSNKKVKQ


>TTHERM_00760630(gene)
ATGGAACAAGAGAACACATTTACCTAATTATACTCCTTCACTTAGTCTAAGGATTCTGAC
CTCTATAAGAACGCCAAGATTGTTTTAGATTCAATCAAGGAAGCTCTTTAGGTAAATTTC
ATTTTTCATTTTTTGCATTTTTACTGCAGTTGTTAATTAGTAGACTTAGGTATTTTAGAT
TATATTTATTAGACAAGATTTATAAAAACTGCATTGAAAATTTTTATTTTTAAGCTCGTG
CTATTACTAATAAAATATTTTATTTATAATTTACAGAAAAAAGGGATGTTTGAAGATAAA
ACTATTTCAACTGCATTATTTGCCAGTTTATTTTAACTACTCTAGTAGGATATAAATGCT
AATAACATATAAAGCGAAGAGCCTAAATTGTTACTTTTCAACTAGCTCTTGACAAAGGTG
AATATGGCTATCGTTATTAAGTTCTATGAATAGATTAGAGAAATGATTTTTAAAGTTTTA
GAATAATAAAGCCGTACCCAATTAACTTAAAAATTTGCTATTGCTATCTTAGTAGAATTA
CTGTAAACATAATAATAAATCGATTAAAATAATGTTGCCTTAGTCAAATTAATTGAAAAT
ATAATTAATGAACAAGTTGCAGCTCGTAAGCAAGCATGGAAAGGCCTAAACACCCTTCTC
TCTTAAAAAATTACTTCTAAATTTATGATTGGTACTGCTGTTACTAAATTTGTTCTTGAT
ATCCTACAAAACAGCTAAGATGATTAAATTTGCATCATAATCACTCAATTTTTAAGCAAC
TCTATTTAGAACCTTCCTATTAATAACGTTAACGATATTTCTTTTGCATTACTTAAGAGA
CTCTAATTAACAACTGATTAAAATCTTGAAGTTCTCATTTACCTTTAATTCGAAGTATGT
CTTTTATTATTTCATTATTTAAGATACAAAAAACATAAAGCTATTTATTCTTTAAATAAG
AAACATGCAAGACAATAAAAATATTAGCAAAAAAATATTTAGGGCAAAAATAGTTTTAGG
GATTTAAAATGCATTGTGAAGATTAGAGTCAAATTTTTTAATTTATTTTTAAAATAAAAA
GAATATAATGAAATTGAGACAACTCAGCTTTGATAACTGCGAAACACTCATTAAGGAATT
TATCGATAACCAACCTAGTTTACATTCTGATCAAAAAGTAGTTATGAGTTATTCATAATG
TCTTATTTAAACTCTTATTTTGATGCACGAACAAAATATTCATGCTGCTAAAAAGTATAT
CCCTACAGTTATTTCTGTGCTTTAGGAAATTATCCTCTCAGTCGATGTTAAGCTTGCAAC
ATTTGGTTAAAAGTAGATGGAAACTTTGATTATTGCAGTTATTGGTGAATATCTTTGGAA
AAAGCATAAAACTGGTGGTTTCCTCAATGAATTTGACTTTACTGAAATCGATAATCTCGG
AGTTGAGTCTTCTACTGCAGATAACACTTTTGAAAAGATTATTTCTATGCTCTAGCACAT
GTTAAGCAACCGTTTCGATAATAGATAAATCTAAGTTCATGGAGTCCTTGGTGTTTTCTT
CCAAAAGATAGATTAAGATTGTAAGCATTTTAAATAATAAAAAAAATAAATATGTTGTTA
AAGAATTATTTGGAATAAATAATATAAATAGGCATGACAGATATAGATGGAATAGTTAAA
GAATTAGTCGAAAATAGAGTTAATAGACACGCTTCAAGTTTTGAAAAGTGCATGGCAAAA
TTAATTTCAAAAATTGGTGCTGGTTTGATTGTTAAAAGATTCCCTCTTCAAATAGCAGGC
TTAAATCCTTTAGCTGAAGACTTTGAAGACAAGAGTAGTTTATGGATGATTCCCATGTTT
TTGAAATACACCAAGAACCAATCTATTGAAGATTTCCTTGAACATATTGTTCCTCACATC
TCTACAATTAAGAATGGTATGGATATTACTTCATAGAAAATGAATGCATAAGAATTAGTT
ATGTTTAATGTTTTCTTATAATTATGGGAGTGCTTTAGCAGATTCCACATCGTTTCTGGT
GAAAAGGGTTTCACTGCTCTTAATTTAATTTTAGATAACTTAGATCCTGAACTCAAGGAT
TCTAATCCTCACTTCGGAAGTATTCTACGTGGTTTGGAGTACAGCTTTAAGTTTATTAGT
CATGCTAAAAATGTTCCTGCTGATACTATTGTGCGTGCATAAAAACTTATCAAATCCATG
CATACTCTTCTCATTCCTGGCAAACCTATTTCTAAATAAATTCTTGCCGTTATTTAATAG
GCTGCTTTTATAGCTCCTAAAGAATATCTTAATTCTGCTTTTGCTCACAACATCAAAAGA
CTTGTCACCACTTCTACTGAAGAAAAAACCAGAGTAAAGCTTAACAACTCAGTCAAAACT
TTTGACATGATACTTGCTGTTTCTTAATCTATGGATTTCAAGAATGATAGATGGGACATG
GCTATGAAATTCATTAAATGCTTCCTTGACGATTAAACTGTATTACAAAAGAAGGCTTAC
AAATTTTTAAGCAATATTGTCTCCAAAGTCCATTATACTTTCCTTCCACAAGTATCTGAA
ATTCTCAAAAATAAATAAGCCACTTAAAGCTCTGCTAGACCTATCAGACTTTAAGTCATT
ACTTAAATTTGGTAACTAAACAAGTTTGATTCAGAAGAATCCTAAGTAGATTAAATTGGT
GAATTCATCTAAACTTTCCTTCCTGAACTTATTGTAGGTTTAAGAGAATCTAACATTCGC
TCTAGAAAAGCTTCCTAAGAACTCTTTAAGAAGATTGCTCAAAAAATGTTAAATTTAAAT
ATGTTAAATGACTTTATATCTATGGTAATTTATTCATTCATTTATCTATTAATTTTGCTT
ACAAATTATTTAAATTTATAAAGATCTCTGCTGGTTTGGGAGCTTCAAGCAGTTTAATGA
AGGCTGACAGTATCGTTTCTATTGCTTATCTCCTTGAGAAATTCGGAAAAAACGTAGACA
CTGCTTTCATTAAAGAAGTTAACTCGATTATTTTGCTTTTGTTAAAGGAATAAAACAAAG
AAATATTTAAAGCTGTTTTAGTTTACTTGAAGGTAATTTTTAAAAAATAATTTTTTCCAG
TATGAAAATAATAAATTTTTTAATATAAAAAAAGAAATATATGAGAATTATCTCAAAGGC
TGAGTTAAAAACCGAATTACCTGATATCTTCAACAATATATTTGAATCTGAATAAGTCAT
TAGAGATAAGCACAGATCACTCATCAAGTAGATTGTTTCAAGATTAATTAGGAAGTTTAC
TAGAACTGTTGTTGAAGATTATGTACCAGAAGCCCATAAGAGAATTGTTAGAGGTATCTT
AAAGGAGGAAAGATACTAAAAGAATAAGGTAAAATTTTAACATTTGATAGCTAAATAATT
TGATAATATAATAAATAAAAAAGAAAATCCGTGAAAGAATTGAAAGGAAGAAGCTAGCTG
CATAAGTTAAGTATAAAGAAACTGACTTTGATGTTTAGCAACGTATGGAATCTGAAAATT
TAGCTAAACAAAAAGAAGAAAAGAACTTGTTGCTTAAATTCGATTAGGATCAACAATAAT
TCCACTTTGTTCCCAACACTGGCTTAAAGAAATTGAAAGAAAGACTTAATGAAGAAAATG
AAAGAAAGGAAGTTGAATATATCAAGGGTAAGATTATCGTACGTGAGGCTATTGAAGATA
TGACTGGTAAAAAGAGAAGAAGAGAAGACAAATATGCTACATATGATTCTATCATTCAAG
AAGAAAGAGACATCAATGATAATGAAAAGACTATCACTTCAAGAAAATTAACTTAGAAAA
GAACAGGTATTACTTTTTATTTTTATTGTAAAATAAATGATTAATTAAAATTATTTTCAT
TCATAAATTAGATAATAAAAACAATCTTGTTCACAACATTAAAGAGTCTGGTGATACTTT
CAAGGCTAAGGGTGAAACTGGTGGTGATGTTGTTAGAAAAGGTAAACCTGATCCATATGC
ATTTATTTAATTGAATCCTAAGGTAATTATTTATTCATTTTCATTTTTGGCAATTATTAA
TATTTGTATGATTAATTAATCAAAAGGCTTTAAATAAGAGACATCAAAAGAGAGCTTCTA
AAGCATTCGATGTTATTATGAATAAAAAAGAAGATGGAGCATTAAAGGGTCTTAAAACTA
GTAACAAAAAGGTGAAATAATGA