Identifiers and Description

Gene Model Identifier

TTHERM_00438910

Standard Name

RRN3 (RNA polymerase I specific transcription initiation factor RRN3)

Aliases

PreTt05448 | 49.m00220 | 3708.m00069

Description

RRN3 RNA polymerase I-specific transcription initiation factor RRN3; RNA polymerase I specific transcription initiation factor

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF05327 ) RNA polymerase I specific transcription

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.4%

TetraMine Data

TTHERM_00438910

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_12433.19.997093137033517e-262hypothetical protein (743 aa)
SGDYKL125W7.001446474249442e-19RRN3 Protein required for tran
scription of rDNA by RNA polym
erase I; transcription factor
independent of DNA template; i
nvolved in recruitment of RNA
polymerase I to rDNA
DictyBaseDDB_G02895870.0000000000000299873730555305DDB_G0289587 on chromosome: 5
position 2981034 to 2983254
WormBaseWBGene000079800.00000000000020009182674645818Uncharacterized protein C36E8.
1 status:Confirmed UniProt
:P48322 protein_id:CAA84645.
1
OxytrichaContig22798.0.g850.00000000019994075865167896RNA polymerase I specific tran
scription initiation factor RR
N3

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00438910(coding)
ATGAGCAAATCAAATACTCATCCAGCACCTCAAATGAGGAAACCAGTAAATATTTAATAA
AATGTGGGGTCCCAAGTTAAGAAGGCCCCTTAGGGTGAACAAATCAGTTAAAAAAATGAT
TCAGCTAATCATGCTTAAATGCAAGAAGATGAAGAAAAAATTTATAGAGTTCTTAGTAGC
TGTTACGACGATTATCTAAAGGGTAATAAGGTTTTAATGAATAAGATCGTGAATGAAATG
TCGAATAGGCACAAGGAAAAGGAACATATAAAAATGTGGTTAAGGGCATCCACTAAAAAG
CTGATTGATCTATTTAAGAATAAGCAAGATGTCAACTTTTTGATAGAGGTAATATTGTAC
TAAATGCCTTGGTTTGAAGCAGGTAACGAATATGAGATTTAGTTGCAAGAGCAAGAGTAG
AAAAAGATACTGTAGCAATAGCAAACTCATGCAAACTAGCAATAGCAGCATGGAATCGGA
AGTAGTACCTCGCTTTTCAGCAATGCATCAAGTTCAAAGAGAAACATTTAGTAGTAGCAT
GGACAATAATTAACAATAAAAAAACCATCTCCTCACTTCGATTTGTTTTCAGAGCTTTCT
AAATTTATAATGACTCTGCTGTCTTTCAGTAATGCCTTTGCACCATAGATTATTAAGTTC
CTCATTTCCAATATTGTGCCTATGGAAGTGAAGGAAATGGAAAAAAATAAGAAATCCGAA
ATAGAATTAGAAGTTGAAGGAAAGGTTTTTGAAAACCAAAAAAAGCTATTAATGTATATC
AGAGACATAATGAATAAGTATATTCTTAACAGTATAAATGACGTCAAAGAATTAAACAAA
GAAGATACTAATTTTTTATTAGGAGTCCTCAAATACCATCCTAATTCAAAAGAAAAAATG
TAAAGATACGTCAAGCTAATTATTGGTTAAGCATAATTCGATGACAAAATCTCGAAATGC
TTATACATTCAAAACAAAGAAGGTTAGAAGATAGATATTTCTTATGTAAAAAGTGTGTTT
AATTTAGTTGATGAATAATTCTAAAAAATTGGATTAAAGCAAGGCTCCCCAAATTAAAAA
AAGATGATGTTACAAGTTGTTGATTTGCTAGCAAAAATAATTAAAATATATCCTCTTTAC
TAAAATGACCTATGTCGCATTTTACAAGAATCTTATCCTCATAGAGTGCAAGGAGAATAA
TTCCATAAAATATATCTTACTAACATTTTATAACTCGCTATTAAATGCCCATAGCTTATG
CCTAAAATACTGATAATTGCTGTTTAAAAATTGATTGAAATAGACTCAGAAATCAAGCTT
GATCATGACGCCTAAGAAAATGAGAAGAATAGTTAAATTATGGCTGAAAAACTTGATTGG
CTGATGCTAATAATTTTTGAATTCATAGATTATTAATTAAAAGATAAAGTTAGTAGCGAT
TCTTGTTTTGGACAAAAAGAAGAATTAAAATAAAATAGCTAAGATAAAAAAGATAAATCT
TAAATGGAAGACAAATTTTTTAAAATATTTTTAAATGTATTTAGTGAATAAATATTAATC
ACCCATTAAAGCAAATATGTTTAGTTTATAATATTTTATCTTTGCTCACTTCGTAACTCA
TTTTAAAACGCTTTTTTAAATCACCTTGTAAAAAATATAACTGAGAAAAATCCTTTGATT
TACAAATCAACCTAAATCAATTCTATTTATTATCTTGGCAGCTACATTGCTCGTGCAAAA
TACATCGAAAATGAAACTATTAGAAAAATATTTGAATACCTTATTACTCATTTAAATAGA
TATATTCAAAAATTTGATGAGAGACAAAAAGAAGAAAACTATAATGAAGGTCTCCATAAA
ATTCACTTAAATTTATACCATCTTTTACAAGCAATGCTTTATATCTTATGCTATCGTTTC
AAAGCAGTCTTAGAAAGCAAAGAAAATCTTTTGTAGAAATTCTACGAGATTATGGACAAG
GCCTGTTCTAATTTTAATGCATTATTTTTTATTTCTCCTCATATTTAAAATGTTTTTAGT
GATGTTTGCGTTAGCTACGGCGAAGATTAATTAGTAGAACTTTTTGAAAAAACTAGCTAA
ACAAGTTAAGCAACAGAATCAATATCAGCTGCTCTGCAACAAAGAGCTTAGCTCTTAGAT
AACTACTTTCCATTTGATCCCTATTGCTTACAATATAGTGATAAGTTTATTTGCGAAATA
TATTAAAATTGGTAAGACACAAATTCTTTATCATCTCAATCTTTTGTTGAATAATAATTA
GAAAAGCAACAACCTTAAACCAATAATAATAAAAAATCCAAAAAAATGTCAAAAGGTAAT
AATGCTAATAATGCTAGCTCTAACTTAAATATCAACAATCCTCCAATAATTTAAAATAGT
CCTCACTTTAATAATAGCCTAAATAATAGTTTTATATGCAGCCAATCTCATAATAATCCT
AACAATATAACAGGAACTTTATTAAATACAAGTAGAAGCAACTATGGTTTCACTATTGAT
AAGCTGAACAATATTAATGACTTAGAATACGACAGGGATAACATGATTTATGATGACGAA
GATGTAAAAGCTAATAATAATAATCATATTTTAGATTTCATAAATGAAAGTGATCCTGAA
TTCTAAATATAATAAGCCAAATATCATAAAGACAAAAAATCTTTAAATGGAAAACGTAAA
AACCCAAGTACGACTGATAATTCTGTGAATAACACTCCAATTACAAATAATGATGAAGAC
AGCAACAATTAACCTATTGTTGACTCAAAAAAAATTAGTAAAAAATCTAAAAAATCTTCT
GATATTGAAGATGATTTTAACAATGCCTCTTTTGGTAATAAAAAGTTGTGCATATAAGAA
ATGTAATTCTGA


>TTHERM_00438910(protein)
MSKSNTHPAPQMRKPVNIQQNVGSQVKKAPQGEQISQKNDSANHAQMQEDEEKIYRVLSS
CYDDYLKGNKVLMNKIVNEMSNRHKEKEHIKMWLRASTKKLIDLFKNKQDVNFLIEVILY
QMPWFEAGNEYEIQLQEQEQKKILQQQQTHANQQQQHGIGSSTSLFSNASSSKRNIQQQH
GQQLTIKKPSPHFDLFSELSKFIMTLLSFSNAFAPQIIKFLISNIVPMEVKEMEKNKKSE
IELEVEGKVFENQKKLLMYIRDIMNKYILNSINDVKELNKEDTNFLLGVLKYHPNSKEKM
QRYVKLIIGQAQFDDKISKCLYIQNKEGQKIDISYVKSVFNLVDEQFQKIGLKQGSPNQK
KMMLQVVDLLAKIIKIYPLYQNDLCRILQESYPHRVQGEQFHKIYLTNILQLAIKCPQLM
PKILIIAVQKLIEIDSEIKLDHDAQENEKNSQIMAEKLDWLMLIIFEFIDYQLKDKVSSD
SCFGQKEELKQNSQDKKDKSQMEDKFFKIFLNVFSEQILITHQSKYVQFIIFYLCSLRNS
FQNAFLNHLVKNITEKNPLIYKSTQINSIYYLGSYIARAKYIENETIRKIFEYLITHLNR
YIQKFDERQKEENYNEGLHKIHLNLYHLLQAMLYILCYRFKAVLESKENLLQKFYEIMDK
ACSNFNALFFISPHIQNVFSDVCVSYGEDQLVELFEKTSQTSQATESISAALQQRAQLLD
NYFPFDPYCLQYSDKFICEIYQNWQDTNSLSSQSFVEQQLEKQQPQTNNNKKSKKMSKGN
NANNASSNLNINNPPIIQNSPHFNNSLNNSFICSQSHNNPNNITGTLLNTSRSNYGFTID
KLNNINDLEYDRDNMIYDDEDVKANNNNHILDFINESDPEFQIQQAKYHKDKKSLNGKRK
NPSTTDNSVNNTPITNNDEDSNNQPIVDSKKISKKSKKSSDIEDDFNNASFGNKKLCIQE
MQF


>TTHERM_00438910(gene)
ATGAGCAAATCAAATACTCATCCAGCACCTCAAATGAGGAAACCAGTAAATATTTAATAA
AATGTGGGGTCCCAAGTTAAGAAGGCCCCTTAGGGTGAACAAATCAGTTAAAAAAATGAT
TCAGCTAATCATGCTTAAATGCAAGAAGATGAAGAAAAAATTTATAGAGTTCTTAGTAGC
TGTTACGACGATTATCTAAAGGTAATTATTTTCGTTTTAAATCACTTTACTTAAATCAAG
AAATCATTTTAAAGCTGATTTATCTCTCTGATCCAAGATTGTTGTTAAGAAATTGTGAAA
AATAATGATGAATTTATTATTAGATGATATAAATTTATGTACTCACTTATATAATATGAC
TCACTTTTATTATTTTATTACACTTAGGGTAATAAGGTTTTAATGAATAAGATCGTGAAT
GAAATGTCGAATAGGCACAAGGAAAAGGAACATATAAAAATGTGGTTAAGGGCATCCACT
AAAAAGCTGATTGATCTATTTAAGAATAAGCAAGATGTCAACTTTTTGATAGAGGTAATA
TTGTACTAAATGCCTTGGTTTGAAGCAGGTAACGAATATGAGATTTAGTTGCAAGAGCAA
GAGTAGAAAAAGATACTGTAGCAATAGCAAACTCATGCAAACTAGCAATAGCAGCATGGA
ATCGGAAGTAGTACCTCGCTTTTCAGCAATGCATCAAGTTCAAAGAGAAACATTTAGTAG
TAGCATGGACAATAATTAACAATAAAAAAACCATCTCCTCACTTCGATTTGTTTTCAGAG
CTTTCTAAATTTATAATGACTCTGCTGTCTTTCAGTAATGCCTTTGCACCATAGATTATT
AAGTTCCTCATTTCCAATATTGTGCCTATGTATTTTATTCTTTTTCTTTATTATACTTCC
TTCATACATCTTTCAATTTTTTTGCTTTTCTTCTACCTTTTTTCGTTTGTTTCTATTTTC
CATATTTAATGCAAACGCTAACCTAACCTAACCATCCAAGCAATCAAGTTTTCATTAATT
CATTCATTCATTCATGCATACTTCTTTAGCATATTTTCTTTTCATCTTCACATCCAATCT
AGCTAAATGGTTCTCATCATCATTCATTCAGTCAATTATTCATTCATTTATTCATTCATT
AGTTTAGTCTTGAGTTTCAATAATACCTTTGGAGTATTTATTAAAATTAGATTTTTCTAA
TATACAAACATAGAAGATATGTGTTTCAAACACCTAACTTAATCAATGTGTGTCAAACCA
TCGATTTGACATGAAGATTGAGTGTGTTTTGCAAAAGATGGCGGAATCAAAATTTTGAAC
GAACGTATGGTTTTTAAGCTCACAAAGTTTGAAAGTGGAACGGAATGAGTTTAGCAAACA
TCATACTGTAATAAAAAGACATATTCTTCAAAGTATCAGGAGACGTTTCAGGGTTCTTTC
GGTCGGTCTCTAGATAAAAGTAATGTAGTGATAGAATTTGTAGAAATTTCATAATATTAT
AATACTAAAATCAACAGAATAATCTTAGTATGAACCAAATAAATAAGACTATCTATCTTG
ATTAAGAGGAAGTTAAATTAATGATCGTTTGTATTCCCATAATCTCAAAGTATTTATAAG
TAAGTATGATGAGAATCAAGAATGACAAGAGCGATCAATCGATTTCATTGTTCTAGCTAG
CTAGATTTATTTATTTATTACAAAGCTGACATTTTCTTTTTATAAAATTTTAATAAGAAA
AGCAAAAATATAATTTTGTTATCTTGAACCTTGCAAAGTTTTTTTTCTAGCAAGACTTAC
TTAAGGCTTAATTAGCCATTTTCCGAAAATAAGCGAAATGGAATAATTATGCTTTAAGTA
GCAAGATACATTTTTAGATGAATAATAGGGATTAAATGTTAAGAAAATTATATAAAAAAT
AGGGAAGTGAAGGAAATGGAAAAAAATAAGAAATCCGAAATAGAATTAGAAGTTGAAGGA
AAGGTTTTTGAAAACCAAAAAAAGCTATTAATGTATATCAGAGACATAATGAATAAGTAT
ATTCTTAACAGTATAAATGACGTCAAAGAATTAAACAAAGAAGATACTAATTTTTTATTA
GGAGTCCTCAAATACCATCCTAATTCAAAAGAAAAAATGTAAAGATACGTCAAGCTAATT
ATTGGTTAAGCATAATTCGATGACAAAATCTCGAAATGCTTATACATTCAAAACAAAGAA
GGTTAGAAGATAGATATTTCTTATGTAAAAAGTGTGTTTAATTTAGTTGATGAATAATTC
TAAAAAATTGGATTAAAGCAAGGCTCCCCAAATTAAAAAAAGATGATGTTACAAGTTGTT
GATTTGCTAGCAAAAATAATTAAAATATATCCTCTTTACTAAAATGACCTATGTCGCATT
TTACAAGAATCTTATCCTCATAGAGTGCAAGGAGAATAATTCCATAAAATATATCTTACT
AACATTTTATAACTCGCTATTAAATGCCCATAGCTTATGCCTAAAATACTGATAATTGCT
GTTTAAAAATTGATTGAAATAGACTCAGAAATCAAGCTTGATCATGACGTAAATAACATT
TATTTGATTATAATTAATTCTTCCTAAATTTGCTATATATTACTTCCATTCATTCATACA
TACATTCATTTTAACTTTATTGATAACTTATTTTCTACATCAATTTAAATTAAATCCTTA
AAAAAATATACTGAGTAAATGGTCATTTATTGCTACGCGGAATCTTTTTTTATAAATAAT
TTCAGAATTTATTAGTAAAACCGCGAAACTGAAGATAAAAATTATTTAATATTAATGCTG
TAAAAAACTCATCACATAAAAAATAATACACTTTTTTTAATTTCTTCACAAAAATTTCTT
TAAAAATCTTAAAGTCAATTTTGTTTTACTTTCTTTATTGTTTGATATTTGAAATTAAAT
TAAATTTTGCAAACAATTATTAGGATAAATTTAAAAAAATTAATTTTGTAATTAAAAAAA
AGCAATCCTTTTAAATGAATGGATGAAACTTAATTAAAAAATTTTAATGAAAATATTTAT
TTATTTCTAAATTTTGAATAAGTATACCATAATTTTTCATAAACTCCCCCATTTTTGTTG
AAAAAAATTTAGAAATCCCCCACCCAAAACCCACATATTTTTTTTTAATTAGACTAGTTA
ATAAGCTCAATTATTAAAAAAAAAATAGATTAAATGTGAATATTATATTAAATGTTTTAA
AATAAATTTTTAATTTAGTAATTTATTAAAATTAAAAATTATAAATAAAAGGCCTAAGAA
AATGAGAAGAATAGTTAAATTATGGCTGAAAAACTTGATTGGCTGATGCTAATAATTTTT
GAATTCATAGATTATTAATTAAAAGATAAAGTTAGTAGCGATTCTTGTTTTGGACAAAAA
GAAGAATTAAAATAAAATAGCTAAGATAAAAAAGATAAATCTTAAATGGAAGACAAATTT
TTTAAAATATTTTTAAATGTATTTAGTGAATAAATATTAATCACCCATTAAAGCAAATAT
GTTTAGTTTATAATATTTTATCTTTGCTCACTTCGTAACTCATTTTAAAACGCTTTTTTA
AATCACCTTGTAAAAAATATAACTGAGAAAAATCCTTTGATTTACAAATCAACCTAAATC
AATTCTATTTATTATCTTGGCAGCTACATTGCTCGTGCAAAATACATCGAAAATGAAACT
ATTAGAAAAATATTTGAATACCTTATTACTCATTTAAATAGATATATTCAAAAATTTGAT
GAGAGACAAAAAGAAGAAAACTATAATGAAGGTCTCCATAAAATTCACTTAAATTTATAC
CATCTTTTACAAGCAATGCTTTATATCTTATGCTATCGTTTCAAAGCAGTCTTAGAAAGC
AAAGAAAATCTTTTGTAGAAATTCTACGAGATTATGGACAAGGCCTGTTCTAATTTTAAT
GCATTATTTTTTATTTCTCCTCATATTTAAAATGTTTTTAGTGATGTTTGCGTTAGCTAC
GGCGAAGATTAATTAGTAGAACTTTTTGAAAAAACTAGCTAAACAAGTTAAGCAACAGAA
TCAATATCAGCTGCTCTGCAACAAAGAGCTTAGCTCTTAGATAACTACTTTCCATTTGAT
CCCTATTGCTTACAATATAGTGATAAGTTTATTTGCGAAATATATTAAAATTGGTAAGAC
ACAAATTCTTTATCATCTCAATCTTTTGTTGAATAATAATTAGAAAAGCAACAACCTTAA
ACCAATAATAATAAAAAATCCAAAAAAATGTCAAAAGGTAATAATGCTAATAATGCTAGC
TCTAACTTAAATATCAACAATCCTCCAATAATTTAAAATAGTCCTCACTTTAATAATAGC
CTAAATAATAGTTTTATATGCAGCCAATCTCATAATAATCCTAACAATATAACAGGAACT
TTATTAAATACAAGTAGAAGCAACTATGGTTTCACTATTGATAAGCTGAACAATATTAAT
GACTTAGAATACGACAGGGATAACATGATTTATGATGACGAAGATGTAAAAGCTAATAAT
AATAATCATATTTTAGATTTCATAAATGAAAGTGATCCTGAATTCTAAATATAATAAGCC
AAATATCATAAAGACAAAAAATCTTTAAATGGAAAACGTAAAAACCCAAGTACGACTGAT
AATTCTGTGAATAACACTCCAATTACAAATAATGATGAAGACAGCAACAATTAACCTATT
GTTGACTCAAAAAAAATTAGTAAAAAATCTAAAAAATCTTCTGATATTGAAGATGATTTT
AACAATGCCTCTTTTGGTAATAAAAAGTTGTGCATATAAGAAATGTAATTCTGA