Identifiers and Description

Gene Model Identifier

TTHERM_00295330

Standard Name

RRM8 (RNA recognition motif-containing protein 8)

Aliases

PreTt15643 | 27.m00303 | 3692.m00106

Description

RNA recognition motif-containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF00076 ) RNA recognition motif. (a.k.a. RRM,

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00295330

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_08800.14.998444157800704e-72polyadenylate-binding protein
2 (610 aa)
DictyBaseDDB_G02706340.0000009995106777214876DDB_G0270634 on chromosome: 1
position 3530459 to 3532109
SGDYPL043W0.0000029996948234116693NOP4 Nucleolar protein, essent
ial for processing and maturat
ion of 27S pre-rRNA and large
ribosomal subunit biogenesis;
constituent of 66S pre-ribosom
al particles; contains four RN
A recognition motifs (RRMs)
WormBaseWBGene000039020.0007999190683310628locus:pab-1 status:Confirmed
UniProt:Q9U302 protein_id
:CAA21572.1

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00295330(coding)
ATGTAATAAACCACCACCACTTAAGATAAAAGGACTCTTTTGAATAAGGAAATTAAATAT
GTTAATTAATAAAACGAGGATGAACTTAAGCAAAAGAAAAAGTATATCTTATTTATTCAT
AATGTTCCTTAAGACCTCGAAACTAGTGCTTTACACAATTTTATGTCTAATTATGGTGAA
ATTATCAATCTTAAGCTTAAGAAGACCGAACAAAACAAGAATTTAGGTTATGGTATCGTT
GAATTCAAAACTGAAGAAGCCTACAATAAAATTTTCAAAGAACAGGAGTTAAATGGTAAG
ATTTCTATTCCAAACTCTAACATATCTATCAATGTCTAAAAGTTCAACGATAGCAACAGA
AAAAAGGCAAACAGATTACTCGTTCTTAATTTATTCGAACAAGAAATCCCAGCTGATTAA
AAGGAATAGAAGGCTTAATAAATCAACATCATTTTCGAGCAAATTAAGAAAGACCTTTAA
GTTCCTCATTTCAAATTCTACACTGAATACAACCATAAATAGAAGAATTTCTGGGTCGTT
TTTGATTTCTAATACGATGATGATAAGCAAGAAGAGCATATTTATAAGACTATTAAGGAA
AAAGTTGAAAAGAACTTCTCATATTCAGGAGCCTAAAACAAGGGACCTTCTATTATCTTC
AAATCTAATGAAAAAAAGTGA


>TTHERM_00295330(protein)
MQQTTTTQDKRTLLNKEIKYVNQQNEDELKQKKKYILFIHNVPQDLETSALHNFMSNYGE
IINLKLKKTEQNKNLGYGIVEFKTEEAYNKIFKEQELNGKISIPNSNISINVQKFNDSNR
KKANRLLVLNLFEQEIPADQKEQKAQQINIIFEQIKKDLQVPHFKFYTEYNHKQKNFWVV
FDFQYDDDKQEEHIYKTIKEKVEKNFSYSGAQNKGPSIIFKSNEKK


>TTHERM_00295330(gene)
ATGTAATAAACCACCACCACTTAAGATAAAAGGACTCTTTTGAATAAGGAAATTAAATAT
GTTAATTAATAAAACGAGGATGAACTTAAGCAAAAGAAAAAGTATATCTTATTTATTCAT
AATGTTCCTTAAGACCTCGAAACTAGTGCTTTACACAATTTTATGTCTAATTATGGTGAA
ATTATCAATCTTAAGCTTAAGAAGACCGAACAAAACAAGAATTTAGGTTATGGTATCGTT
GAATTCAAAACTGAAGAAGCCTACAATAAAATTTTCAAAGAACAGGAGTTAAATGGTAAG
ATTTCTATTCCAAACTCTAACATATCTATCAATGTCTAAAAGTTCAACGATAGCAACAGA
AAAAAGGCAAACAGATTACTCGTTCTTAATTTATTCGAACAAGAAATCCCAGCTGATTAA
AAGGAATAGAAGGCTTAATAAATCAACATCATTTTCGAGCAAATTAAGAAAGACCTTTAA
GTTCCTCATTTCAAATTCTACACTGAATACAACCATAAATAGAAGAATTTCTGGGTCGTT
TTTGATTTCTAATACGATGATGATAAGCAAGAAGAGCATATTTATAAGACTATTAAGGAA
AAAGTTGAAAAGAACTTCTCATATTCAGGAGCCTAAAACAAGGGACCTTCTATTATCTTC
AAATCTAATGAAAAAAAGTGA