Identifiers and Description

Gene Model Identifier

TTHERM_00051700

Standard Name

RRM70 (RNA recognition motif-containing protein 70 )

Aliases

PreTt11351 | 3.m01740 | 3824.m03104

Description

RNA recognition motif-containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00051700

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_01598.16.997785648757479e-148hypothetical protein (977 aa)
WormBaseWBGene000222533.999672240330216e-26locus:hrpf-2 status:Confirme
d UniProt:Q8MXR2 protein_i
d:CCD74180.1

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00051700(coding)
ATGGATAAGGGAGGTTGTGGTGATTAGAAGAATATATTAATTGTATTACACGGGGATTTA
AAAATAAATAACTAGAAAAACCTTAGTGATGGTCATCAAAATAATGCCAGCACTGGTAAT
AGTAATATTGGGGTGGTGGAAGAGAAGACAAGCGAAGATCTTTAGCAACAACAACAACAA
CAACAAATACAACTTCAAACATTAACAACATTATCAACAATTACTTCATCTTAATTATCG
GAATTATGCTGGGAGGTTTTTGATCTGCAAAACAAAAAAAGTCTTACGGATGTTCAATCT
ATCAAGCAGGAAGATTTTAATTTGTAGAGTATTTAAAGCTATATTCAAGATATTTCTTAA
GACCCTACAATATAAATTTCATTTTTAATTTCTGATTCATAACTTTATTCTGTTTTGTAA
GGGATGAGTAATTTGAACTGGATTTACAAATATGAGATATTTGACATCTTACATTAAGCA
GAGTTAATATTTTCTGATAAAAAAGATTCCATAAAAGACTTGATTAATTACTTCTCATTT
TAGAATGATTAGTAAACAGCTTAAAAATCTGAAACTTTTTAGACAGCTACGTTAATATCT
AAAATTGTCTCTATTATGCTCAGGACAACTATCCCTTTCAAAGATCCACTGAATTAAGAA
ATTTTGAAATTAAAGAATCAGAACCTGACTTCTAAGATGGAAAACAAAGAATCTTAAAAA
AATATTTTATAAAGTCCTTAATTAAAAATTATAAGATAGTCAAGTGAAAGCTCAAATTAG
AGACAAATTATAGATAAAGAAGAGCTATGGAGTGATCCAAAAGGCTTGCTTATTAATGGT
GGTTCACATTATTTCTTGAAACTTAGAGGGATACCTTATAATGCAAAAGAGTCAGAAGTT
TAAGACTTTTTAGGTTTAACATTAGACAAGTATCAAATGGTTTTTAAATATGATAAAAAT
GAAAAATTTACAGGAGAATGCTTTATTAAAGCAAAGGATCAAGATCAATTTGATAAAATA
AAAAGTATGCATAAAAAAACTATGAAAAATAGGTATATTGAGATATTTGTAGCTGATAAA
ATTGAATTTGTTTAAGCTTAAGAATCATAAAATATGAATGATAGTAACTTTTACTTAACT
GAAAAAGGTAATTCATCTAACTTAGGGCATGGATTAGGACAACTAATTACATCCTCAAGT
AAGAAAGAAAGTGATAATTAGATTAAAGATAGAAAGAAGGCATCTAGAAGAGATGTATCG
AGAAGTAGAAGCTCCAGAAGTAAAGAAAAGACTTCTAAAAGTAGCAGCAGAAAATCTAAT
AGCTTTTCCTCATCTTCTTCATAATCATCATCTTCACATATTAGGACTTAAGACAGCTAA
AGTGATAGTAAATATTCTAAGTCTGGTAGTAGAAGTGATTCTTATCATTATCTAAGGCTA
AGGGGACTTCCCTTCAATGCCAGAGAAGCTGAAATCTAATAATTTTTAGGAATAAGTTTA
GAATAAGATTAAATTACTTTTAAGCATGACAATGATGGCAGATTTAGTGGTGAGTGTGTC
ATTAGAACTAAGGATCAAAACTAACTAGACAAAATAAAAGATAAGCACATGAGAAATATG
GGTAAGAGGTATATTGAAGTATTTGTTGCTGAATAAAGTGATTTTGTTCGTGCTTAAGAT
TCTCAAATTATTGATGATTAAAAAGTTGGTATATCCTAAATTAATTCACAAATAGACCCA
AATCTTCTTTAGAGTGCAAACATTGTTAAAATAAGAGGTTTACCATATAATGCAACGGAC
TAAGATATCTAAAAATTCTTCAAAGATTCACAAATTGTTCAAAATGGTATTTAAAAAGTC
TATGATGGAAAAAGACCTTCAGGTGAGGCTTTTATTATATTTGCTACAAAGCAGGATGCT
CAAAAAGCTATAGAAAAAGATAAAGAAAAAATGGGCAGTCGTTATATTGAAATATTTTTG
AGTCACTTAAAAGAATTTACTAACCACATAAAAAAGAGAAAATCCTACTCTGGAAGCAAT
GGCAATTCGAACGGAGGCTCAAGCTCTTCTAATTCATCTAATAAGTTTTCAAATCACGGA
AATAACGGAAATCGCTACGATAAACATTCTAACAGCTCAGGGGGATTTTCAAATCATAAT
AATCATGGAAGAAATAATAATAACGAAGGCAGGTTCAATAACCATCACTCTAGATACAGT
AACTCACCTCACCGTAATTATGGTAACAACGGAAATAACCATAATAACTCCTAAAACGGA
TCAGGTTTTTATAAAAAAGGAAATGGATAGACAAATGGAAATTATGATCGTAACGCAAAA
GGTTTTTAGGAAAATTAGTATTCATCTAAATTTTCAAATAATGAAGAGAAATTTAGCAAC
ATGAATCATAGCAGCAGCAGTAGTAGTAAAGGATACTCGAATAACTACAATAATAATTAA
AATTAAATGCATAGTAATAATGGTAACGGTAATCATAATTATGGAAACAGAAATAATAGC
AATTATTAAAACGATTTTAGTAGAAATTTTAAAAACAAAGGGAAGGAAGACTAAGGAAAA
TACAGTGGAAGCAATAAGTAATATGATAATAACTAATTTAATTAATCTTAATAACACAAT
TAATATTAACACCAATCTTAGTCAAACCATAACTAGCAACAATAGCCTTACAGTAAGAAT
TAAGGAGGACCTTAAACTTAAAATGATGGTAATTATTATGGAGGAAATTATGATTACCAA
TACTAAAATTAATAATAAAATAATTCTTAATAAATGAATTAACATTAATCTTCATCTGGA
TACCATTAAGAAAACAATTAGCTTAACAAAAATTATAATAATAACTCAAATGAAAATTAA
TAATATTCTCACCATCAACCTAGCTAATAGTAAAGCTACTATAATAATAACTCTAATTCA
GGCTAATATCATTAATAATAATAGTAGTATTAAAATTAATAGTATAACTAAAATAACTCT
TTTGATCCTTAGCATCAACCAATTAATTATAGTTAGTATAGCAATTAAAATAACCATAAT
TAATAGAATTATCCTCCTAACAACTACTACGGTTAAAATTAACAAGATCACCATTCATAG
TAGCAGAATCATTTAAACATAGGTTAATAAGGTCATCCTTTAAATACGAATGGATCTCAA
AACTCTCAACCATAATACTACCAACAAAATATGTTTGACATTCAACACCAACAACAATAA
TAGCAATATCGCTATTACTGA


>TTHERM_00051700(protein)
MDKGGCGDQKNILIVLHGDLKINNQKNLSDGHQNNASTGNSNIGVVEEKTSEDLQQQQQQ
QQIQLQTLTTLSTITSSQLSELCWEVFDLQNKKSLTDVQSIKQEDFNLQSIQSYIQDISQ
DPTIQISFLISDSQLYSVLQGMSNLNWIYKYEIFDILHQAELIFSDKKDSIKDLINYFSF
QNDQQTAQKSETFQTATLISKIVSIMLRTTIPFKDPLNQEILKLKNQNLTSKMENKESQK
NILQSPQLKIIRQSSESSNQRQIIDKEELWSDPKGLLINGGSHYFLKLRGIPYNAKESEV
QDFLGLTLDKYQMVFKYDKNEKFTGECFIKAKDQDQFDKIKSMHKKTMKNRYIEIFVADK
IEFVQAQESQNMNDSNFYLTEKGNSSNLGHGLGQLITSSSKKESDNQIKDRKKASRRDVS
RSRSSRSKEKTSKSSSRKSNSFSSSSSQSSSSHIRTQDSQSDSKYSKSGSRSDSYHYLRL
RGLPFNAREAEIQQFLGISLEQDQITFKHDNDGRFSGECVIRTKDQNQLDKIKDKHMRNM
GKRYIEVFVAEQSDFVRAQDSQIIDDQKVGISQINSQIDPNLLQSANIVKIRGLPYNATD
QDIQKFFKDSQIVQNGIQKVYDGKRPSGEAFIIFATKQDAQKAIEKDKEKMGSRYIEIFL
SHLKEFTNHIKKRKSYSGSNGNSNGGSSSSNSSNKFSNHGNNGNRYDKHSNSSGGFSNHN
NHGRNNNNEGRFNNHHSRYSNSPHRNYGNNGNNHNNSQNGSGFYKKGNGQTNGNYDRNAK
GFQENQYSSKFSNNEEKFSNMNHSSSSSSKGYSNNYNNNQNQMHSNNGNGNHNYGNRNNS
NYQNDFSRNFKNKGKEDQGKYSGSNKQYDNNQFNQSQQHNQYQHQSQSNHNQQQQPYSKN
QGGPQTQNDGNYYGGNYDYQYQNQQQNNSQQMNQHQSSSGYHQENNQLNKNYNNNSNENQ
QYSHHQPSQQQSYYNNNSNSGQYHQQQQQYQNQQYNQNNSFDPQHQPINYSQYSNQNNHN
QQNYPPNNYYGQNQQDHHSQQQNHLNIGQQGHPLNTNGSQNSQPQYYQQNMFDIQHQQQQ
QQYRYY


>TTHERM_00051700(gene)
ATGGATAAGGGAGGTTGTGGTGGTAAAAAGAAATAATAATAATAAAAACAAAGAATAATG
GGATATTTATTTTATATTATTAAATATTGTTAGATTAGAAGAATATATTAATTGTATTAC
ACGGGGATTTAAAAATAAATAACTAGAAAAACCTTAGTGATGGTCATCAAAATAATGCCA
GCACTGGTAATAGTAATATTGGGGTGGTGGAAGAGAAGACAAGCGAAGATCTTTAGCAAC
AACAACAACAACAACAAATACAACTTCAAACATTAACAACATTATCAACAATTACTTCAT
CTTAATTATCGGAATTATGCTGGGAGGTTTTTGATCTGCAAAACAAAAAAAGTCTTACGG
ATGTTCAATCTATCAAGCAGGAAGTACATACATATATAATTCACAAAAAGAGTTTTTTTT
GATTTTATTTCATCTTTATCTTTACCACAGATGACAAACATATATCAGACAAAAATGTCT
AAAAATAGCAAGTAGCTGTATAAATAATTAAAGAATTCTTATTTTTCTTTTGCTAATTGC
ATTTAAAAGCTACCCCCTTATCAAATATTGATTAATTAATTAAGAAAGGATTTACACAAA
AATTAAATTTTAGAGTGATTGATTAATTTATGCATTTTTTTCTTCTATTTATTTGATCAC
TAAAATATAAAATCTTATTCATTCATTAAAACAAACTTCCTATTTTAAATTAATTAATTA
GTTATTATAATAATAACTAATTACATTAGATTTTTTTCGAATAATATTTTTTCTTCTATT
TTTCTTTATTCTACATACATACTTCTGTGAACACTCAAATCAATTAATAAATAAATAAAT
AATGCTGGATAAATAACAAAATAAAATAAAATTATTAGCAATGTAAATCAATCAATCAAT
CAATCAATCCATTTCGCACTTTTAGTTTAAATATACAATTTTTATTTTCAACATCTTATT
CTCTGTAAAATACCAGAGGTAACAACATCGATTTGTATCAATACTATTTTCAAAATAATA
AAATAAATACTTATTGTTAAAATGGGAAAAATTCAATAGAGGATAAACTGGAAAATAGAT
TATTTTGTTGGAGGTTTTCTTTGTATAGGGAAATATCTGCATTAAGATATTAATAGGCAT
ATTATTTTCAAAAGGGAGCAAAAATTATATTAATTACTCATAGCAATATAAAGGGTGTTT
ATTAAATTTTTGGGATGATTTGTAATCAGTTAGTTAGTTGTCTTCAGCAATTTTCATGTT
TGGAGGAATTCTATTTGCTCATCATTAAGTCTATCTTTTCGTTAAAAAATATTATTTGAT
TTGATGAAAAAAGAGAAAAAACTAATAATTAGTTATCTTTAATTAATTATTAAATTTAGC
AATTGATATCTGTCAGTCATTCAGTCAGGATTAATAATGTTGAATTAGATTGAAATCGTA
GCTTTAAGATTCAATTAAAGAATTATTTTTCTACTTTTTTTCTATTTCAAAACCCATAAA
ATGGAGGAAAAAGGGGTTTATATTTTTGGTTTAAACAGTTTATAGTCGAATAAACAGTCA
TTTAAATGCAAATAGCAAAAACAATATTTTAATGGGTAAAGATGGAAAAACATTTGATAT
TTCTGAATAGAAAAATCTATAATTTACTACATGAAAAGCAAATAATTTACTTTAAAAAAA
CTAATTCATTTTTTATTATGAAAAAAGGATTTTAATTTGTAGAGTATTTAAAGCTATATT
CAAGATATTTCTTAAGACCCTACAATATAAATTTCATTTTTAATTTCTGATTCATAACTT
TATTCTGTTTTGTAAGGGATGAGTAATTTGAACTGGATTTACAAATATGAGATATTTGAC
ATCTTACATTAAGCAGAGTTAATATTTTCTGATAAAAAAGATTCCATAAAAGACTTGATT
AATTACTTCTCATTTTAGAATGATTAGTAAACAGCTTAAAAATCTGAAACTTTTTAGACA
GCTACGTTAATATCTAAAATTGTCTCTATTATGCTCAGGACAACTATCCCTTTCAAAGAT
CCACTGAATTAAGAAATTTTGAAATTAAAGAATCAGAACCTGACTTCTAAGATGGTAAAA
TTTTAAAATAAATTTATTTGATTGATATAGTTTTAATTTAATTAAATAATTAAAAATTAG
GAAAACAAAGAATCTTAAAAAAATATTTTATAAAGTCCTTAATTAAAAATTATAAGATAG
TCAAGTGAAAGCTCAAATTAGAGACAAATTATAGATAAAGAAGAGCTATGGAGTGATCCA
AAAGGCTTGCTTATTAATGGTGGTTCACATTATTTCTTGAAACTTAGAGGGATACCTTAT
AATGCAAAAGAGTCAGAAGTTTAAGACTTTTTAGGTTTAACATTAGACAAGTATCAAATG
GTTTTTAAATATGATAAAAATGAAAAATTTACAGGAGAATGCTTTATTAAAGCAAAGGAT
CAAGATCAATTTGATAAAATAAAAAGTATGCATAAAAAAACTATGAAAAATAGGTATATT
GAGATATTTGTAGCTGATAAAATTGAATTTGTTTAAGCTTAAGAATCATAAAATATGAAT
GATAGTAACTTTTACTTAACTGAAAAAGGTAATTCATCTAACTTAGGGCATGGATTAGGA
CAACTAATTACATCCTCAAGTAAGAAAGAAAGTGATAATTAGATTAAAGATAGAAAGAAG
GCATCTAGAAGAGATGTATCGAGAAGTAGAAGCTCCAGAAGTAAAGAAAAGACTTCTAAA
AGTAGCAGCAGAAAATCTAATAGCTTTTCCTCATCTTCTTCATAATCATCATCTTCACAT
ATTAGGACTTAAGACAGCTAAAGTGATAGTAAATATTCTAAGTCTGGTAGTAGAAGTGAT
TCTTATCATTATCTAAGGCTAAGGGGACTTCCCTTCAATGCCAGAGAAGCTGAAATCTAA
TAATTTTTAGGAATAAGTTTAGAATAAGATTAAATTACTTTTAAGCATGACAATGATGGC
AGATTTAGTGGTGAGTGTGTCATTAGAACTAAGGATCAAAACTAACTAGACAAAATAAAA
GATAAGCACATGAGAAATATGGGTAAGAGGTATATTGAAGTATTTGTTGCTGAATAAAGT
GATTTTGTTCGTGCTTAAGATTCTCAAATTATTGATGATTAAAAAGTTGGTATATCCTAA
ATTAATTCACAAATAGACCCAAATCTTCTTTAGAGTGCAAACATTGTTAAAATAAGAGGT
TTACCATATAATGCAACGGACTAAGATATCTAAAAATTCTTCAAAGATTCACAAATTGTT
CAAAATGGTATTTAAAAAGTCTATGATGGAAAAAGACCTTCAGGTGAGGCTTTTATTATA
TTTGCTACAAAGCAGGATGCTCAAAAAGCTATAGAAAAAGATAAAGAAAAAATGGGCAGT
CGTTATATTGAAATATTTTTGAGTCACTTAAAAGAATTTACTAACCACATAAAAAAGAGA
AAATCCTACTCTGGAAGCAATGGCAATTCGAACGGAGGCTCAAGCTCTTCTAATTCATCT
AATAAGTTTTCAAATCACGGAAATAACGGAAATCGCTACGATAAACATTCTAACAGCTCA
GGGGGATTTTCAAATCATAATAATCATGGAAGAAATAATAATAACGAAGGCAGGTTCAAT
AACCATCACTCTAGATACAGTAACTCACCTCACCGTAATTATGGTAACAACGGAAATAAC
CATAATAACTCCTAAAACGGATCAGGTTTTTATAAAAAAGGAAATGGATAGACAAATGGA
AATTATGATCGTAACGCAAAAGGTTTTTAGGAAAATTAGTATTCATCTAAATTTTCAAAT
AATGAAGAGAAATTTAGCAACATGAATCATAGCAGCAGCAGTAGTAGTAAAGGATACTCG
AATAACTACAATAATAATTAAAATTAAATGCATAGTAATAATGGTAACGGTAATCATAAT
TATGGAAACAGAAATAATAGCAATTATTAAAACGATTTTAGTAGAAATTTTAAAAACAAA
GGGAAGGAAGACTAAGGAAAATACAGTGGAAGCAATAAGTAATATGATAATAACTAATTT
AATTAATCTTAATAACACAATTAATATTAACACCAATCTTAGTCAAACCATAACTAGCAA
CAATAGCCTTACAGTAAGAATTAAGGAGGACCTTAAACTTAAAATGATGGTAATTATTAT
GGAGGAAATTATGATTACCAATACTAAAATTAATAATAAAATAATTCTTAATAAATGAAT
TAACATTAATCTTCATCTGGATACCATTAAGAAAACAATTAGCTTAACAAAAATTATAAT
AATAACTCAAATGAAAATTAATAATATTCTCACCATCAACCTAGCTAATAGTAAAGCTAC
TATAATAATAACTCTAATTCAGGCTAATATCATTAATAATAATAGTAGTATTAAAATTAA
TAGTATAACTAAAATAACTCTTTTGATCCTTAGCATCAACCAATTAATTATAGTTAGTAT
AGCAATTAAAATAACCATAATTAATAGAATTATCCTCCTAACAACTACTACGGTTAAAAT
TAACAAGATCACCATTCATAGTAGCAGAATCATTTAAACATAGGTTAATAAGGTCATCCT
TTAAATACGAATGGATCTCAAAACTCTCAACCATAATACTACCAACAAAATATGTTTGAC
ATTCAACACCAACAACAATAATAGCAATATCGCTATTACTGA