Identifiers and Description

Gene Model Identifier

TTHERM_00051700

Standard Name

RRM70 (RNA recognition motif-containing protein 70 )

Aliases

PreTt11351 | 3.m01740 | 3824.m03104

Description

RRM70 RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein hnRNP protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 11.8%

TetraMine Data

TTHERM_00051700

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_01598.16.997785648757479e-148hypothetical protein (977 aa)
WormBaseWBGene000222533.999672240330216e-26locus:hrpf-2 status:Confirme
d UniProt:Q8MXR2 protein_i
d:CCD74180.1

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00051700(coding)
ATGGATAAGGGAGGTTGTGGTGATTAGAAGAATATATTAATTGTATTACACGGGGATTTA
AAAATAAATAACTAGAAAAACCTTAGTGATGGTCATCAAAATAATGCCAGCACTGGTAAT
AGTAATATTGGGGTGGTGGAAGAGAAGACAAGCGAAGATCTTTAGCAACAACAACAACAA
CAACAAATACAACTTCAAACATTAACAACATTATCAACAATTACTTCATCTTAATTATCG
GAATTATGCTGGGAGGTTTTTGATCTGCAAAACAAAAAAAGTCTTACGGATGTTCAATCT
ATCAAGCAGGAAGATTTTAATTTGTAGAGTATTTAAAGCTATATTCAAGATATTTCTTAA
GACCCTACAATATAAATTTCATTTTTAATTTCTGATTCATAACTTTATTCTGTTTTGTAA
GGGATGAGTAATTTGAACTGGATTTACAAATATGAGATATTTGACATCTTACATTAAGCA
GAGTTAATATTTTCTGATAAAAAAGATTCCATAAAAGACTTGATTAATTACTTCTCATTT
TAGAATGATTAGTAAACAGCTTAAAAATCTGAAACTTTTTAGACAGCTACGTTAATATCT
AAAATTGTCTCTATTATGCTCAGGACAACTATCCCTTTCAAAGATCCACTGAATTAAGAA
ATTTTGAAATTAAAGAATCAGAACCTGACTTCTAAGATGGAAAACAAAGAATCTTAAAAA
AATATTTTATAAAGTCCTTAATTAAAAATTATAAGATAGTCAAGTGAAAGCTCAAATTAG
AGACAAATTATAGATAAAGAAGAGCTATGGAGTGATCCAAAAGGCTTGCTTATTAATGGT
GGTTCACATTATTTCTTGAAACTTAGAGGGATACCTTATAATGCAAAAGAGTCAGAAGTT
TAAGACTTTTTAGGTTTAACATTAGACAAGTATCAAATGGTTTTTAAATATGATAAAAAT
GAAAAATTTACAGGAGAATGCTTTATTAAAGCAAAGGATCAAGATCAATTTGATAAAATA
AAAAGTATGCATAAAAAAACTATGAAAAATAGGTATATTGAGATATTTGTAGCTGATAAA
ATTGAATTTGTTTAAGCTTAAGAATCATAAAATATGAATGATAGTAACTTTTACTTAACT
GAAAAAGGTAATTCATCTAACTTAGGGCATGGATTAGGACAACTAATTACATCCTCAAGT
AAGAAAGAAAGTGATAATTAGATTAAAGATAGAAAGAAGGCATCTAGAAGAGATGTATCG
AGAAGTAGAAGCTCCAGAAGTAAAGAAAAGACTTCTAAAAGTAGCAGCAGAAAATCTAAT
AGCTTTTCCTCATCTTCTTCATAATCATCATCTTCACATATTAGGACTTAAGACAGCTAA
AGTGATAGTAAATATTCTAAGTCTGGTAGTAGAAGTGATTCTTATCATTATCTAAGGCTA
AGGGGACTTCCCTTCAATGCCAGAGAAGCTGAAATCTAATAATTTTTAGGAATAAGTTTA
GAATAAGATTAAATTACTTTTAAGCATGACAATGATGGCAGATTTAGTGGTGAGTGTGTC
ATTAGAACTAAGGATCAAAACTAACTAGACAAAATAAAAGATAAGCACATGAGAAATATG
GGTAAGAGGTATATTGAAGTATTTGTTGCTGAATAAAGTGATTTTGTTCGTGCTTAAGAT
TCTCAAATTATTGATGATTAAAAAGTTGGTATATCCTAAATTAATTCACAAATAGACCCA
AATCTTCTTTAGAGTGCAAACATTGTTAAAATAAGAGGTTTACCATATAATGCAACGGAC
TAAGATATCTAAAAATTCTTCAAAGATTCACAAATTGTTCAAAATGGTATTTAAAAAGTC
TATGATGGAAAAAGACCTTCAGGTGAGGCTTTTATTATATTTGCTACAAAGCAGGATGCT
CAAAAAGCTATAGAAAAAGATAAAGAAAAAATGGGCAGTCGTTATATTGAAATATTTTTG
AGTCACTTAAAAGAATTTACTAACCACATAAAAAAGAGAAAATCCTACTCTGGAAGCAAT
GGCAATTCGAACGGAGGCTCAAGCTCTTCTAATTCATCTAATAAGTTTTCAAATCACGGA
AATAACGGAAATCGCTACGATAAACATTCTAACAGCTCAGGGGGATTTTCAAATCATAAT
AATCATGGAAGAAATAATAATAACGAAGGCAGGTTCAATAACCATCACTCTAGATACAGT
AACTCACCTCACCGTAATTATGGTAACAACGGAAATAACCATAATAACTCCTAAAACGGA
TCAGGTTTTTATAAAAAAGGAAATGGATAGACAAATGGAAATTATGATCGTAACGCAAAA
GGTTTTTAGGAAAATTAGTATTCATCTAAATTTTCAAATAATGAAGAGAAATTTAGCAAC
ATGAATCATAGCAGCAGCAGTAGTAGTAAAGGATACTCGAATAACTACAATAATAATTAA
AATTAAATGCATAGTAATAATGGTAACGGTAATCATAATTATGGAAACAGAAATAATAGC
AATTATTAAAACGATTTTAGTAGAAATTTTAAAAACAAAGGGAAGGAAGACTAAGGAAAA
TACAGTGGAAGCAATAAGTAATATGATAATAACTAATTTAATTAATCTTAATAACACAAT
TAATATTAACACCAATCTTAGTCAAACCATAACTAGCAACAATAGCCTTACAGTAAGAAT
TAAGGAGGACCTTAAACTTAAAATGATGGTAATTATTATGGAGGAAATTATGATTACCAA
TACTAAAATTAATAATAAAATAATTCTTAATAAATGAATTAACATTAATCTTCATCTGGA
TACCATTAAGAAAACAATTAGCTTAACAAAAATTATAATAATAACTCAAATGAAAATTAA
TAATATTCTCACCATCAACCTAGCTAATAGTAAAGCTACTATAATAATAACTCTAATTCA
GGCTAATATCATTAATAATAATAGTAGTATTAAAATTAATAGTATAACTAAAATAACTCT
TTTGATCCTTAGCATCAACCAATTAATTATAGTTAGTATAGCAATTAAAATAACCATAAT
TAATAGAATTATCCTCCTAACAACTACTACGGTTAAAATTAACAAGATCACCATTCATAG
TAGCAGAATCATTTAAACATAGGTTAATAAGGTCATCCTTTAAATACGAATGGATCTCAA
AACTCTCAACCATAATACTACCAACAAAATATGTTTGACATTCAACACCAACAACAATAA
TAGCAATATCGCTATTACTGA


>TTHERM_00051700(protein)
MDKGGCGDQKNILIVLHGDLKINNQKNLSDGHQNNASTGNSNIGVVEEKTSEDLQQQQQQ
QQIQLQTLTTLSTITSSQLSELCWEVFDLQNKKSLTDVQSIKQEDFNLQSIQSYIQDISQ
DPTIQISFLISDSQLYSVLQGMSNLNWIYKYEIFDILHQAELIFSDKKDSIKDLINYFSF
QNDQQTAQKSETFQTATLISKIVSIMLRTTIPFKDPLNQEILKLKNQNLTSKMENKESQK
NILQSPQLKIIRQSSESSNQRQIIDKEELWSDPKGLLINGGSHYFLKLRGIPYNAKESEV
QDFLGLTLDKYQMVFKYDKNEKFTGECFIKAKDQDQFDKIKSMHKKTMKNRYIEIFVADK
IEFVQAQESQNMNDSNFYLTEKGNSSNLGHGLGQLITSSSKKESDNQIKDRKKASRRDVS
RSRSSRSKEKTSKSSSRKSNSFSSSSSQSSSSHIRTQDSQSDSKYSKSGSRSDSYHYLRL
RGLPFNAREAEIQQFLGISLEQDQITFKHDNDGRFSGECVIRTKDQNQLDKIKDKHMRNM
GKRYIEVFVAEQSDFVRAQDSQIIDDQKVGISQINSQIDPNLLQSANIVKIRGLPYNATD
QDIQKFFKDSQIVQNGIQKVYDGKRPSGEAFIIFATKQDAQKAIEKDKEKMGSRYIEIFL
SHLKEFTNHIKKRKSYSGSNGNSNGGSSSSNSSNKFSNHGNNGNRYDKHSNSSGGFSNHN
NHGRNNNNEGRFNNHHSRYSNSPHRNYGNNGNNHNNSQNGSGFYKKGNGQTNGNYDRNAK
GFQENQYSSKFSNNEEKFSNMNHSSSSSSKGYSNNYNNNQNQMHSNNGNGNHNYGNRNNS
NYQNDFSRNFKNKGKEDQGKYSGSNKQYDNNQFNQSQQHNQYQHQSQSNHNQQQQPYSKN
QGGPQTQNDGNYYGGNYDYQYQNQQQNNSQQMNQHQSSSGYHQENNQLNKNYNNNSNENQ
QYSHHQPSQQQSYYNNNSNSGQYHQQQQQYQNQQYNQNNSFDPQHQPINYSQYSNQNNHN
QQNYPPNNYYGQNQQDHHSQQQNHLNIGQQGHPLNTNGSQNSQPQYYQQNMFDIQHQQQQ
QQYRYY


>TTHERM_00051700(gene)
ATGGATAAGGGAGGTTGTGGTGGTAAAAAGAAATAATAATAATAAAAACAAAGAATAATG
GGATATTTATTTTATATTATTAAATATTGTTAGATTAGAAGAATATATTAATTGTATTAC
ACGGGGATTTAAAAATAAATAACTAGAAAAACCTTAGTGATGGTCATCAAAATAATGCCA
GCACTGGTAATAGTAATATTGGGGTGGTGGAAGAGAAGACAAGCGAAGATCTTTAGCAAC
AACAACAACAACAACAAATACAACTTCAAACATTAACAACATTATCAACAATTACTTCAT
CTTAATTATCGGAATTATGCTGGGAGGTTTTTGATCTGCAAAACAAAAAAAGTCTTACGG
ATGTTCAATCTATCAAGCAGGAAGTACATACATATATAATTCACAAAAAGAGTTTTTTTT
GATTTTATTTCATCTTTATCTTTACCACAGATGACAAACATATATCAGACAAAAATGTCT
AAAAATAGCAAGTAGCTGTATAAATAATTAAAGAATTCTTATTTTTCTTTTGCTAATTGC
ATTTAAAAGCTACCCCCTTATCAAATATTGATTAATTAATTAAGAAAGGATTTACACAAA
AATTAAATTTTAGAGTGATTGATTAATTTATGCATTTTTTTCTTCTATTTATTTGATCAC
TAAAATATAAAATCTTATTCATTCATTAAAACAAACTTCCTATTTTAAATTAATTAATTA
GTTATTATAATAATAACTAATTACATTAGATTTTTTTCGAATAATATTTTTTCTTCTATT
TTTCTTTATTCTACATACATACTTCTGTGAACACTCAAATCAATTAATAAATAAATAAAT
AATGCTGGATAAATAACAAAATAAAATAAAATTATTAGCAATGTAAATCAATCAATCAAT
CAATCAATCCATTTCGCACTTTTAGTTTAAATATACAATTTTTATTTTCAACATCTTATT
CTCTGTAAAATACCAGAGGTAACAACATCGATTTGTATCAATACTATTTTCAAAATAATA
AAATAAATACTTATTGTTAAAATGGGAAAAATTCAATAGAGGATAAACTGGAAAATAGAT
TATTTTGTTGGAGGTTTTCTTTGTATAGGGAAATATCTGCATTAAGATATTAATAGGCAT
ATTATTTTCAAAAGGGAGCAAAAATTATATTAATTACTCATAGCAATATAAAGGGTGTTT
ATTAAATTTTTGGGATGATTTGTAATCAGTTAGTTAGTTGTCTTCAGCAATTTTCATGTT
TGGAGGAATTCTATTTGCTCATCATTAAGTCTATCTTTTCGTTAAAAAATATTATTTGAT
TTGATGAAAAAAGAGAAAAAACTAATAATTAGTTATCTTTAATTAATTATTAAATTTAGC
AATTGATATCTGTCAGTCATTCAGTCAGGATTAATAATGTTGAATTAGATTGAAATCGTA
GCTTTAAGATTCAATTAAAGAATTATTTTTCTACTTTTTTTCTATTTCAAAACCCATAAA
ATGGAGGAAAAAGGGGTTTATATTTTTGGTTTAAACAGTTTATAGTCGAATAAACAGTCA
TTTAAATGCAAATAGCAAAAACAATATTTTAATGGGTAAAGATGGAAAAACATTTGATAT
TTCTGAATAGAAAAATCTATAATTTACTACATGAAAAGCAAATAATTTACTTTAAAAAAA
CTAATTCATTTTTTATTATGAAAAAAGGATTTTAATTTGTAGAGTATTTAAAGCTATATT
CAAGATATTTCTTAAGACCCTACAATATAAATTTCATTTTTAATTTCTGATTCATAACTT
TATTCTGTTTTGTAAGGGATGAGTAATTTGAACTGGATTTACAAATATGAGATATTTGAC
ATCTTACATTAAGCAGAGTTAATATTTTCTGATAAAAAAGATTCCATAAAAGACTTGATT
AATTACTTCTCATTTTAGAATGATTAGTAAACAGCTTAAAAATCTGAAACTTTTTAGACA
GCTACGTTAATATCTAAAATTGTCTCTATTATGCTCAGGACAACTATCCCTTTCAAAGAT
CCACTGAATTAAGAAATTTTGAAATTAAAGAATCAGAACCTGACTTCTAAGATGGTAAAA
TTTTAAAATAAATTTATTTGATTGATATAGTTTTAATTTAATTAAATAATTAAAAATTAG
GAAAACAAAGAATCTTAAAAAAATATTTTATAAAGTCCTTAATTAAAAATTATAAGATAG
TCAAGTGAAAGCTCAAATTAGAGACAAATTATAGATAAAGAAGAGCTATGGAGTGATCCA
AAAGGCTTGCTTATTAATGGTGGTTCACATTATTTCTTGAAACTTAGAGGGATACCTTAT
AATGCAAAAGAGTCAGAAGTTTAAGACTTTTTAGGTTTAACATTAGACAAGTATCAAATG
GTTTTTAAATATGATAAAAATGAAAAATTTACAGGAGAATGCTTTATTAAAGCAAAGGAT
CAAGATCAATTTGATAAAATAAAAAGTATGCATAAAAAAACTATGAAAAATAGGTATATT
GAGATATTTGTAGCTGATAAAATTGAATTTGTTTAAGCTTAAGAATCATAAAATATGAAT
GATAGTAACTTTTACTTAACTGAAAAAGGTAATTCATCTAACTTAGGGCATGGATTAGGA
CAACTAATTACATCCTCAAGTAAGAAAGAAAGTGATAATTAGATTAAAGATAGAAAGAAG
GCATCTAGAAGAGATGTATCGAGAAGTAGAAGCTCCAGAAGTAAAGAAAAGACTTCTAAA
AGTAGCAGCAGAAAATCTAATAGCTTTTCCTCATCTTCTTCATAATCATCATCTTCACAT
ATTAGGACTTAAGACAGCTAAAGTGATAGTAAATATTCTAAGTCTGGTAGTAGAAGTGAT
TCTTATCATTATCTAAGGCTAAGGGGACTTCCCTTCAATGCCAGAGAAGCTGAAATCTAA
TAATTTTTAGGAATAAGTTTAGAATAAGATTAAATTACTTTTAAGCATGACAATGATGGC
AGATTTAGTGGTGAGTGTGTCATTAGAACTAAGGATCAAAACTAACTAGACAAAATAAAA
GATAAGCACATGAGAAATATGGGTAAGAGGTATATTGAAGTATTTGTTGCTGAATAAAGT
GATTTTGTTCGTGCTTAAGATTCTCAAATTATTGATGATTAAAAAGTTGGTATATCCTAA
ATTAATTCACAAATAGACCCAAATCTTCTTTAGAGTGCAAACATTGTTAAAATAAGAGGT
TTACCATATAATGCAACGGACTAAGATATCTAAAAATTCTTCAAAGATTCACAAATTGTT
CAAAATGGTATTTAAAAAGTCTATGATGGAAAAAGACCTTCAGGTGAGGCTTTTATTATA
TTTGCTACAAAGCAGGATGCTCAAAAAGCTATAGAAAAAGATAAAGAAAAAATGGGCAGT
CGTTATATTGAAATATTTTTGAGTCACTTAAAAGAATTTACTAACCACATAAAAAAGAGA
AAATCCTACTCTGGAAGCAATGGCAATTCGAACGGAGGCTCAAGCTCTTCTAATTCATCT
AATAAGTTTTCAAATCACGGAAATAACGGAAATCGCTACGATAAACATTCTAACAGCTCA
GGGGGATTTTCAAATCATAATAATCATGGAAGAAATAATAATAACGAAGGCAGGTTCAAT
AACCATCACTCTAGATACAGTAACTCACCTCACCGTAATTATGGTAACAACGGAAATAAC
CATAATAACTCCTAAAACGGATCAGGTTTTTATAAAAAAGGAAATGGATAGACAAATGGA
AATTATGATCGTAACGCAAAAGGTTTTTAGGAAAATTAGTATTCATCTAAATTTTCAAAT
AATGAAGAGAAATTTAGCAACATGAATCATAGCAGCAGCAGTAGTAGTAAAGGATACTCG
AATAACTACAATAATAATTAAAATTAAATGCATAGTAATAATGGTAACGGTAATCATAAT
TATGGAAACAGAAATAATAGCAATTATTAAAACGATTTTAGTAGAAATTTTAAAAACAAA
GGGAAGGAAGACTAAGGAAAATACAGTGGAAGCAATAAGTAATATGATAATAACTAATTT
AATTAATCTTAATAACACAATTAATATTAACACCAATCTTAGTCAAACCATAACTAGCAA
CAATAGCCTTACAGTAAGAATTAAGGAGGACCTTAAACTTAAAATGATGGTAATTATTAT
GGAGGAAATTATGATTACCAATACTAAAATTAATAATAAAATAATTCTTAATAAATGAAT
TAACATTAATCTTCATCTGGATACCATTAAGAAAACAATTAGCTTAACAAAAATTATAAT
AATAACTCAAATGAAAATTAATAATATTCTCACCATCAACCTAGCTAATAGTAAAGCTAC
TATAATAATAACTCTAATTCAGGCTAATATCATTAATAATAATAGTAGTATTAAAATTAA
TAGTATAACTAAAATAACTCTTTTGATCCTTAGCATCAACCAATTAATTATAGTTAGTAT
AGCAATTAAAATAACCATAATTAATAGAATTATCCTCCTAACAACTACTACGGTTAAAAT
TAACAAGATCACCATTCATAGTAGCAGAATCATTTAAACATAGGTTAATAAGGTCATCCT
TTAAATACGAATGGATCTCAAAACTCTCAACCATAATACTACCAACAAAATATGTTTGAC
ATTCAACACCAACAACAATAATAGCAATATCGCTATTACTGA