Identifiers and Description

Gene Model Identifier

TTHERM_00285680

Standard Name

RRM7 (RNA recognition motif-containing protein 7)

Aliases

PreTt25897 | 26.m00249 | 3688.m00045

Description

RNA recognition motif-containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF05316 ) Mitochondrial ribosomal protein (VAR1)
  • ( PF00642 ) Zinc finger C-x8-C-x5-C-x3-H type (and
  • ( PF00076 ) RNA recognition motif. (a.k.a. RRM,

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 11.1%

TetraMine Data

TTHERM_00285680

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_09285.19.997093137033517e-262hypothetical protein (1120 aa)
OxytrichaContig22254.0.g551.0002124404074584e-26RNA recognition motif_ (a_k_a_
RRM, RBD, or RNP domain)
SGDYER068W9.000561397357242e-21MOT2 Subunit of the CCR4-NOT c
omplex, which has roles in tra
nscription regulation, mRNA de
gradation, and post-transcript
ional modifications; with Ubc4
p, ubiquitinates nascent polyp
eptide-associated complex subu
nits and histone demethyase Jh
d2p
WormBaseWBGene000038273.0002687256732656e-20locus:ntl-4 status:Partially
_confirmed protein_id:CDM634
98.1
Stentor CoeruleusSteCoe_325140.000000002061153622438558

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00285680(coding)
ATGAGTAGCGATAAAAACAAAGGCGGATTCAAAGTAGTCAATGGTCCTAAATCAAATTAA
GGAGCCCTTATCTCAACCCTCTCTATAAATTAAGCAAATTCAAATTAAAATTTACAGGAA
TAAAGAATCATACAAACAAATTTAGTATTTTTGAATGGACTCGATGCAAAGCTTTGTAAA
GAAGAGGTTTTAAAGAAGAAGCAGTATATGGGATAGTATGGAAATGTTAAAAAAGTTATT
TTAAAGCAGGAGGGTAATAGAGATTAAAATTCAGTTGGTGTTTATGTTTCATATTCTTCT
CCTAATGAGGCTTCAATTGCGATATTAGCATTAGATTAATTTGAACTCGATAGCAAGCCA
TTAAGAGCATTTTATGGATCAACTAAATACTGTAATTCATTTTTAAATGGCTAATAATGT
ATTAAAAAAGATTGTCCTTATTTGCATGAAAAAGCAAAAGAGCATACATTTTATAAAGAT
TAAAGATTTTATATAAATTATAAAGAAATAGCATTAAAAATAGTGAATTAAAAAATTAGT
TTTTACAATAATTATTCATCAGTTTAAAACCCTATATTTCCAGATGTTATGATAGTATTA
AATGAATTAAAATCTTAATTATAAATACCTGATACACTCACTACTGCAGTATTAAAAGCG
AACGATTCTAAGAACTCTGCAGTTATTATTAATAATATTACAGCATGTACTTGGGATGAT
GATGATGCTATGACAAATGAGGGAATTTAAAATTAAAATTAAGATTAAAATTAAAATTTT
GAGATTTAAAACTAAGAATATATTTAAAATTAAGACATTAACATCACTCAGAAAGATATA
AACTTATTTAATTAAAATACAAACTAGTTACAGCACCCTTTATTTGATTTAAAATCTATG
AATACTTTAAATTATTATAAGATGGTCGAAAAATTAGATTTGCCTTTTTAAAATCCTAAT
TTGTATTAGTTATTATAACAACCTGATATACAATAATAGCTTGGTATAAATTAATACATT
AACAGGGTAGAGCTTGATTCTATAAATTACTCACCAAATTAATTCTATTTTGATGATAAA
TTTTAACTAGCAGAAAATTCTTAAACTAGTAGATTTTTTAATGACTCTAGCAAGAGCTTT
AAATTTAAAAATATATGGGGACCTGTTGGTTAAAAAAAAAGCTCACTTAAAATTGAAAAT
CCTAATAATCCTAATTATATAAATGGTTTGTAAGGAAATGATTGCATATAATTACCTCAA
AGTAATGAAGAAGATGAATTTAGTGTGCTTAACACATTTATTTTGGCATATAACATTACT
CATAGTTTGTGGATTCCTTATGTCAAATTGCAAAATTTAACTGAAAAGATATTTAAAAAA
CTACTGGTTGATCAATAAATATCTTAATTTAGTTTCAATAAATACATGTTTGATAATGAT
AACTGGATGTTGGAATTCCTTGAAAATAACTTATTTACTGATGAAGAAAAAGAAATTATT
TTGAGTGCTGCTAGAAGTACATTTAAGGATAAAAATCTACTATATGTTGATATTGCTCCA
TAATGTGTTGACTTGTTTACTCCTGTAGTTGAACAGAAGCAGCAATTGCAAGAGGTTTAA
ACAATATTTACTTTACATCCGAATCATTAAAAGCAAAGAAAAAGATCTTCGAATTCTCTT
TAGAGCACTAATCACAGCAGTATGGGTGGAGAGCTAGCAGATCTTGAGGAGAGTAAACAC
AATGAAGAAAACAGCTAACTGATAAAAAGCAATATTTTTCCTTAATCTTCAAATTAAAGT
AAAACAAGCAAAACAAAATTAAATAATAATGCATAATCAAGTTCTTCTGATGCACCTAAA
AAAGCTGAAGAAAAATAGCAAAGTGTTTAAAATATAAATAAACCAATAAAGAGTAGTTCC
ATAACTAGTCAACCTAGTAATTTATCTTCTTCAATTGTTAAGAATGAGTTTCAAATCTAA
AAATAATCTAGTAACTAAAACTCATAAAAGTTAGAGCTTAATAAAAGCGCTTCTTAATAG
TCTTCAAAAAATATAAATTCAACTGTCAACTAGCAAGTAAAAACAATTTAAAAAACAACT
TAAAATCCTGCAAGCAATACTGCTAATACTAATAAAGTAAATGGAACTAAAGTTGTCTCT
AGTTCCACTTCATAGCAAGAAACTTAAATAAAAAAGCAGGAATCAGAAAAAGAAAAGAAT
GAACAAGATGAAGAATTTGTGAGCATTTAGCCAAAAGGAGGAGCTATAAAATTGGAATTA
GCTGACAAAAAGAAGGAGAGAGTTGATAACAACATGTTCACATTTTTAGAAAATGAATAA
GAAGAAGATGAAGATAAAGATAAAGATAAAGAGGAACAATAAAAGCAAAAGAATGATAAT
ACAACTAAAAAGCAAAAAACCAAAGTAAAATAAGCTGAAAAACCTGAGAAAAAGACCTCA
AAAAAAATGAACTCTAAATAGCTAGAGCAATAATAATTGAAGGAAGAGAAGAAAAAGAGG
TAGGAGGAATATCAGCTTTTAAATGAACAACTTAATCTGATCAAATAAGAGAAAGAAAAA
AACAAGTAAAAACAGCAGGAGTAAAAGCAAGAATAGATGCAATAACAGCAAAAAAAAAAG
TAAAAAGAGTAAGAGAAGGAATAGTAACAATAGGCATAAGCTGATAAATCTTAAATTTTG
AATCCTTTGATAAATGGAGGTTGCTTGAAGTTTAATTGTAATTCAATAAATTGCCACGAA
ATAAGCGGCTAACAGATTTTAGTGCAAAATGGTGAAATTCAAATTCCTTAAATTAAGCAG
AGCACTTTTGATAAAAAGAGAAAGAAAAGACAAGAAAGCAGTCTTAATAGCATTGACATA
TAGAAATAAATTAGCAACTTAATGAGCATAGACCCAAAGGCATTTTAATTTCAAAATTAG
AATAGATTAGTTAACTAGTAATTAGCATTCCATGCTGAAGCTAGCGTTACTAATATAAAT
GTGACTAAAGAAGGCATAAATATAAGTGCTAATATTACTAAATCAACTCAGTAAGGACTC
TTACCACCAGAAATTACAAAAAATGCTTCTAAAATTTAAATGCCAAACAACATAGTAGTT
CGTTTTGATAATGTAGATAATACAAACAAAACTTCTACAATACAAAATACTATATCTACC
AATGTTCCTATTGATAGTAAACTGAACTATAGATCTAGCAAATCTAAAAATGAGAAAAAT
CTTGCAAATAAGAAGAAAGAAGAGAAGCAAGTTTAGTATGAAAGCAAAGTGTACCACAGT
GATTTAATAAGTGAGTAGGCTGTGTACAAAGGCACTCCAGAGGTAGGAATTAATGATGAT
AATGAGTGA


>TTHERM_00285680(protein)
MSSDKNKGGFKVVNGPKSNQGALISTLSINQANSNQNLQEQRIIQTNLVFLNGLDAKLCK
EEVLKKKQYMGQYGNVKKVILKQEGNRDQNSVGVYVSYSSPNEASIAILALDQFELDSKP
LRAFYGSTKYCNSFLNGQQCIKKDCPYLHEKAKEHTFYKDQRFYINYKEIALKIVNQKIS
FYNNYSSVQNPIFPDVMIVLNELKSQLQIPDTLTTAVLKANDSKNSAVIINNITACTWDD
DDAMTNEGIQNQNQDQNQNFEIQNQEYIQNQDINITQKDINLFNQNTNQLQHPLFDLKSM
NTLNYYKMVEKLDLPFQNPNLYQLLQQPDIQQQLGINQYINRVELDSINYSPNQFYFDDK
FQLAENSQTSRFFNDSSKSFKFKNIWGPVGQKKSSLKIENPNNPNYINGLQGNDCIQLPQ
SNEEDEFSVLNTFILAYNITHSLWIPYVKLQNLTEKIFKKLLVDQQISQFSFNKYMFDND
NWMLEFLENNLFTDEEKEIILSAARSTFKDKNLLYVDIAPQCVDLFTPVVEQKQQLQEVQ
TIFTLHPNHQKQRKRSSNSLQSTNHSSMGGELADLEESKHNEENSQLIKSNIFPQSSNQS
KTSKTKLNNNAQSSSSDAPKKAEEKQQSVQNINKPIKSSSITSQPSNLSSSIVKNEFQIQ
KQSSNQNSQKLELNKSASQQSSKNINSTVNQQVKTIQKTTQNPASNTANTNKVNGTKVVS
SSTSQQETQIKKQESEKEKNEQDEEFVSIQPKGGAIKLELADKKKERVDNNMFTFLENEQ
EEDEDKDKDKEEQQKQKNDNTTKKQKTKVKQAEKPEKKTSKKMNSKQLEQQQLKEEKKKR
QEEYQLLNEQLNLIKQEKEKNKQKQQEQKQEQMQQQQKKKQKEQEKEQQQQAQADKSQIL
NPLINGGCLKFNCNSINCHEISGQQILVQNGEIQIPQIKQSTFDKKRKKRQESSLNSIDI
QKQISNLMSIDPKAFQFQNQNRLVNQQLAFHAEASVTNINVTKEGINISANITKSTQQGL
LPPEITKNASKIQMPNNIVVRFDNVDNTNKTSTIQNTISTNVPIDSKLNYRSSKSKNEKN
LANKKKEEKQVQYESKVYHSDLISEQAVYKGTPEVGINDDNE


>TTHERM_00285680(gene)
ATGAGTAGCGATAAAAACAAAGGCGGATTCAAAGTAGTCAATGGTCCTAAATCAAATTAA
GGAGCCCTTATCTCAACCCTCTCTATAAATTAAGCAAATTCAAATTAAAGTAGATTTATT
TTAGATTTTCGCTTATTAGAAATATTTTTTTTTGTGTATGCGTTATTATGATATTTACAA
ATATCTCATTTAGATAATTCATTAATGTAGTTTTTTCATAAATTCAACAGATTTACAGGA
ATAAAGAATCATACAAACAAATTTAGTATTTTTGAATGGACTCGATGCAAAGCTTTGTAA
AGAAGAGGTAACAAGATGCACAAACATTATAAGAAGATTTTAGTTTTAAAAAAGCCTACA
ATTTAAAAAAAAACAAGCAAAAAAAGGCTTGTTTATAAGCTATGATAATTTAATACTTTT
ATCTTTAAGTTTCTTAAGTACTTTCAAAAAGAAGCTGGCTTGCTTCAATGTTAAAACTAA
AAAAGCAAAAGCAAAATAAAATATTTTTTTGACATTATTTATCATAAAATTAGGTTTTAA
AGAAGAAGCAGTATATGGGATAGTATGGAAATGTTAAAAAAGTTATTTTAAAGCAGGAGG
GTAATAGAGATTAAAATTCAGTTGGTGTTTATGTTTCATATTCTTCTCCTAATGAGGCTT
CAATTGCGATATTAGTAATAGAATAATAACTACTTTCTATTTGATTATTTTCTATTAAAT
GCTTTTATTTTATTCCCGCGCTCAAAGTGCTTCAACTCAATTTTTATTTATTAATAGGCA
TTAGATTAATTTGAACTCGATAGCAAGCCATTAAGAGCATTTTATGGATCAACTAAGTAG
GCATTAAAATATATTTCTTCTTTTTCTCTTCTTCTCTCTTTTATATATATATCTCTAACT
TTTTACCAGCAAACCAAAAGAATATTACGCCAAGTGCTCTTATAATTAACTCATAAAAAT
AATAAGCTAAAGGGATCATGATCATAAATCTTTTTTTAGCTATTTTGAGCCATTTATTCA
CTTTATTATAGTTTTTGAATATCACTTCTAGCATTTAAATTGCAATTTTTAGAGACTAAC
AACAAACACTTGTTGAATTAATATGCCACTAAAAAGTTAAAGAAATATGTTTTTACTTAA
ACATATTTAGGGATTTATGAAGCATTTAGGTTAGTTGGTTTGATTTGGAGATATATAGAC
AAAGAGAAAGATAGATAATAAATAAAACAGTTATTTAAAATAATACTTAATATTTTCATA
ATATAAATAAAATAGATACTGTAATTCATTTTTAAATGGCTAATAATGTATTAAAAAAGA
TTGTCCTTATTTGCATGAAAAAGCAAAAGAGCATACATTTTATAAAGTAAGTTTAGTCTT
TATTGATTAGCTTGGAAATATTAATTAACAACATATCTATCTATCAGTCTGGCTTAATCT
TGATCTTTTTTATTAAAAAAAAAATGAATTTTTACATTTTTAAAATTATTGGTTGGAAAT
CAATCTGAATTTAATAAATTATTTATTTCCTTAAAAATTCCTTTACATTTAAAGAATATT
CTATAGGATAAAACAAATTGGTTATCAGCAAATAAAAATATTGTATTCAATATGGCAAAC
TATATACTTAACTAATGTTTAAAGAGATATCAAATATTTAAAAGTTAATAGCATCTTAAA
TAAAAGGAAATAATTTAGACATTAAAATACATCAAGTTAAATAAAATATTTAGGAAAAAA
TCTTTTTTAAAATTGTATAAGAAATAATTTTTATTGAATTAGGAGCTATGTAAAAAAAAG
AAAATAAATATTGATTATTTAATATCAAAAAGTGAGTAAGGAAGGAAGTAAGGATATTTT
GTAAATTAAGAGATAAGATGAGACTGATTGATTGATAAATAAATAAATAAATAAAATTTT
ATAATGAAAAAAATATTTACTTATAAATTAATTTTATTTTAATAAAAATAATAAATTAAT
AGGATTAAAGATTTTATATAAATTATAAAGAAATAGCATTAAAAATAGTGAATTAAAAAA
TTAGTTTTTACAATAATTATTCATCAGTTTAAAACCCTATATTTCCAGATGTTATGATAG
TATTAAATGAATTAAAATCTTAATTATAAATACCTGATACACTCACTACTGCAGTATTAA
AAGCGAACGATTCTAAGAACTCTGCAGTTATTATTAATAATATTACAGCATGTAATTAAT
CATTTTGCATCTTATTTTCAACTAACAATCGTTGTTGTAATTTTAAAAAGGTACTTGGGA
TGATGATGATGCTATGACAAATGAGGGAATTTAAAATTAAAATTAAGATTAAAATTAAAA
TTTTGAGATTTAAAACTAAGAATATATTTAAAATTAAGACATTAACATCACTCAGAAAGA
TATAAACTTATTTAATTAAAATACAAACTAGTTACAGCACCCTTTATTTGATTTAAAATC
TATGAATACTTTAAATTATTATAAGATGGTCGAAAAATTAGATTTGCCTTTTTAAAATCC
TAATTTGTATTAGTTATTATAACAACCTGATATACAATAATAGCTTGGTATAAATTAATA
CATTAACAGGGTAGAGCTTGATTCTATAAATTACTCACCAAATTAATTCTATTTTGATGA
TAAATTTTAACTAGCAGAAAATTCTTAAACTAGTAGATTTTTTAATGACTCTAGCAAGAG
CTTTAAATTTAAAAATATATGGGGACCTGTTGGTTAAAAAAAAAGCTCACTTAAAATTGA
AAATCCTAATAATCCTAATTATATAAATGGTTTGTAAGGAAATGATTGCATATAATTACC
TCAAAGTAATGAAGAAGATGAATTTAGTGTGCTTAACACATTTATTTTGGCATATAACAT
TACTCATAGTTTGTGGATTCCTTATGTCAAATTGCAAAATTTAACTGAAAAGATATTTAA
AAAACTACTGGTTGATCAATAAATATCTTAATTTAGTTTCAATAAATACATGTTTGATAA
TGATAACTGGATGTTGGAATTCCTTGAAAATAACTTATTTACTGATGAAGAAAAAGAAAT
TATTTTGAGTGCTGCTAGAAGTACATTTAAGGATAAAAATCTACTATATGTTGATATTGC
TCCATAATGTGTTGACTTGTTTACTCCTGTAGTTGAACAGAAGCAGCAATTGCAAGAGGT
TTAAACAATATTTACTTTACATCCGAATCATTAAAAGCAAAGAAAAAGATCTTCGAATTC
TCTTTAGGTATAATAATTCGATTTAAAAAATAGCTAAAATTTAAATAATTTTATACAGAG
CACTAATCACAGCAGTATGGGTGGAGAGCTAGCAGATCTTGAGGAGAGTAAACACAATGA
AGAAAACAGCTAACTGATAAAAAGCAATATTTTTCCTTAATCTTCAAATTAAAGTAAAAC
AAGCAAAACAAAATTAAATAATAATGCATAATCAAGTTCTTCTGATGCACCTAAAAAAGC
TGAAGAAAAATAGCAAAGTGTTTAAAATATAAATAAACCAATAAAGAGTAGTTCCATAAC
TAGTCAACCTAGTAATTTATCTTCTTCAATTGTTAAGAATGAGTTTCAAATCTAAAAATA
ATCTAGTAACTAAAACTCATAAAAGTTAGAGCTTAATAAAAGCGCTTCTTAATAGTCTTC
AAAAAATATAAATTCAACTGTCAACTAGCAAGTAAAAACAATTTAAAAAACAACTTAAAA
TCCTGCAAGCAATACTGCTAATACTAATAAAGTAAATGGAACTAAAGTTGTCTCTAGTTC
CACTTCATAGCAAGAAACTTAAATAAAAAAGCAGGAATCAGAAAAAGAAAAGAATGAACA
AGATGAAGAATTTGTGAGCATTTAGCCAAGTAAAATTATTTTTATTTAAACACAGATTTA
TTTGATGAATTTGTCTATATTTTTATATTGATAATTAATTAAATAATTTATTTACTAAAT
GATTAGAAGGAGGAGCTATAAAATTGGAATTAGCTGACAAAAAGAAGGAGAGAGTTGATA
ACAACATGTTCACATTTTTAGAAAATGAATAAGAAGAAGATGAAGATAAAGATAAAGATA
AAGAGGAACAATAAAAGCAAAAGAATGATAATACAACTAAAAAGCAAAAAACCAAAGTAA
AATAAGCTGAAAAACCTGAGAAAAAGACCTCAAAAAAAATGAACTCTAAATAGCTAGAGC
AATAATAATTGAAGGAAGAGAAGAAAAAGAGGTAGGAGGAATATCAGCTTTTAAATGAAC
AACTTAATCTGATCAAATAAGAGAAAGAAAAAAACAAGTAAAAACAGCAGGAGTAAAAGC
AAGAATAGATGCAATAACAGCAAAAAAAAAAGTAAAAAGAGTAAGAGAAGGAATAGTAAC
AATAGGCATAAGCTGATAAATCTTAAATTTTGAATCCTTTGATAAATGGAGGTTGCTTGA
AGTTTAATTGTAATTCAATAAATTGCCACGAAATAAGCGGCTAACAGATTTTAGTGCAAA
ATGGTGAAATTCAAATTCCTTAAATTAAGCAGAGCACTTTTGATAAAAAGAGAAAGAAAA
GACAAGAAAGCAGTCTTAATAGCATTGACATATAGAAATAAATTAGCAACTTAATGAGCA
TAGACCCAAAGGCATTTTAATTTCAAAATTAGAATAGATTAGTTAACTAGTAATTAGCAT
TCCATGCTGAAGCTAGCGTTACTAATATAAATGTGACTAAAGAAGGCATAAATATAAGTG
CTAATATTACTAAATCAACTCAGTAAGGACTCTTACCACCAGAAATTACAAAAAATGCTT
CTAAAATTTAAATGCCAAACAACATAGTAGTTCGTTTTGATAATGTAGATAATACAAACA
AAACTTCTACAATACAAAATACTATATCTACCAATGTTCCTATTGATAGTAAACTGAACT
ATAGATCTAGCAGTAAAATAAAAATAATTTAATATCCATATTGTAATTTATTAATACTAA
AATTTTAGAATCTAAAAATGAGAAAAATCTTGCAAATAAGAAGAAAGAAGAGAAGCAAGT
TTAGTATGAAAGCAAAGGTATTTAATTTTTTTTAATTGATTTATCATTTTAACTTAAAAT
ATTTTTTATAAAATAGTGTACCACAGTGATTTAATAAGTAAATATAATCTTACTCAATTT
AAAATTTTAGATTAACTTTTTTGAAATTAAATTTATATTATTTAATGAAAAGGTGAGTAG
GCTGTGTACAAAGGCACTCCAGAGGTAGGAATTAATGGTAAAATATATTCAATATTTTTT
AATTTTATTTAATCTTTTTATAATTAAACAGATGATAATGAGTGA