Identifiers and Description

Gene Model Identifier

TTHERM_00245200

Standard Name

RRM69 (RNA recognition motif-containing protein 69)

Aliases

PreTt02416 | 21.m00247

Description

RNA recognition motif-containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF00076 ) RNA recognition motif. (a.k.a. RRM,

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00245200

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_00625.19.997093137033517e-262hypothetical protein (569 aa)
WormBaseWBGene000063677.998932288246191e-33locus:sym-2 RNA-binding prot
ein sym-2 status:Confirmed
UniProt:Q22708 protein_id:C
AA93887.2
OxytrichaContig17166.0.g712.99851380290819e-19RNA recognition motif (a_k_a_
RRM, RBD, or RNP domain)
Stentor CoeruleusSteCoe_150120.0000000000018795288165390832

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00245200(coding)
ATGAATCAAGGTTTTGATTATTTAATAGTATTAACATCAGGTTAAACAAAAGAATTGGAG
AGAAACAATTAGGAGGAATAGAAATAGAGCACAAGCAACAATCTTTAAAATTAACTCCAA
GAAGATAATGATTCTACTGAGTAGCTTGGAAGGATGATAGAGTTTAATTGGTGCATTTAC
GATACTAAAAAGTAAATCGTCACTGAATAGTTCTAAAGATTCATCAAGGGAGAAGATTTC
TTAGTTAATAATGAGACTCTTACCAAAAATAAAATCACTCTTAGCAAGTTCGATGGTGCA
TTGCTATTTAGCAAGCTTATTTAGGAGTTTAATGATTACACATATACTAATTTCACACGC
TAAAACAAGAGTTTCTGCATAGTCACTTACGGAGATGCTCTCATGACTAGAATCTTACCC
AGAGAAGCTTAATTTAATCAAATGAAACTTGCTTCCCACTTTTTCACTTATTTTGACATA
AGAAATGAATTCAAAAAGAATTTCTCTCATGCCATATCTATCAAAACACTACATGAAATG
TTAACATACACTAATCTCCAAGAAAAACCACTTTTAGACTAATCTATAGGGTAATTTGAA
ATGAGCAACATAGTAAGATTAGTAAATATGCTTGTAAGAAGCGGATATGTCTTCAATCAT
CCTAAATTGATCAATAACTCTTATCAAGTTGTGTTAGACAATTAGGACTCTAAGACTAGA
TATATTCAATCAAGAGAAAAGAAGTCAAAAAATAATTATGTCAGAGGCAGAAGCCCTGAA
CCATTTAAAAACCTTTCACAATAACATTTTATTCGCATAAGAGGCCTTCCTTACTCTGCA
AGAGAACCTGAAATCTACGAATTACTTAAAAATATTAGGATTTATAAAGAGGATATTGCT
TTTCTTTATGATAGCGAAGGTAAATTCTCTGGAGAAGCATATGTAAGAGTTTACAGCTAG
CTAGATAAACAAGAAGCTTTGTGCTACAATTTAAATAAGGTTGAAGGAAGATTTGTTGAG
ATTTTCGAAACTACAGAAAATGAATTTAATAGAGCTAAAATTTCTTAATTCCCAGAAAAG
AGAAATCAAGATGATGAGCTACCAAATGAAACTCAATTTGATCTCAATAAAATAGTCACT
GAAGGAGCAGGAGTAGTAAGAATTAGAGGCTTACCCTACTCTTGTACTGAAGAAGATATT
AAAAAATTCTTTAAAGGATTAACTATTTTACAAGGAGGTATTAAGAGAGCTATTCTTGGT
GGCAGACCTGGAGGAGAGTGTTTTGTAATATTTTAAAACAAGGATGATGCTCATAAAGCT
CTTAATTTTCATATGGAAAAAATTCACAACAGATTTATAGAAGTTTTCTTAGCCACAGTT
AAGGAATTCGAAAATTATATGGCACATAACTTTGTTAATTCTGCTCCTGTTTATAGTAAA
GATAACATGCCAAATATTCCACAAGAGAAAAGAAAATCAACTCTCATGGTTATGGGAATG
CCTTTCAGTGTAACTAAATAAAAGATTTTAGAGTTCTTCAAAGGATTTGACATCAATGAA
AGAGAAATACATCTTCTTTGCTCTCATACTGGCAAATTTAGTGGATCAGCTCTCGTTACA
TTCGAAGACGAGCTTGAAGCCCAAAGAGCTCTAAAAACAAAGAATTTCTCATATATTGAA
AATAGATATTTAGAATTATTTGAGTATAAATGA


>TTHERM_00245200(protein)
MNQGFDYLIVLTSGQTKELERNNQEEQKQSTSNNLQNQLQEDNDSTEQLGRMIEFNWCIY
DTKKQIVTEQFQRFIKGEDFLVNNETLTKNKITLSKFDGALLFSKLIQEFNDYTYTNFTR
QNKSFCIVTYGDALMTRILPREAQFNQMKLASHFFTYFDIRNEFKKNFSHAISIKTLHEM
LTYTNLQEKPLLDQSIGQFEMSNIVRLVNMLVRSGYVFNHPKLINNSYQVVLDNQDSKTR
YIQSREKKSKNNYVRGRSPEPFKNLSQQHFIRIRGLPYSAREPEIYELLKNIRIYKEDIA
FLYDSEGKFSGEAYVRVYSQLDKQEALCYNLNKVEGRFVEIFETTENEFNRAKISQFPEK
RNQDDELPNETQFDLNKIVTEGAGVVRIRGLPYSCTEEDIKKFFKGLTILQGGIKRAILG
GRPGGECFVIFQNKDDAHKALNFHMEKIHNRFIEVFLATVKEFENYMAHNFVNSAPVYSK
DNMPNIPQEKRKSTLMVMGMPFSVTKQKILEFFKGFDINEREIHLLCSHTGKFSGSALVT
FEDELEAQRALKTKNFSYIENRYLELFEYK


>TTHERM_00245200(gene)
ATGAATCAAGGTTTTGATTATTTAATAGTATTAACATCAGGTTAAACAAAAGAATTGGAG
AGAAACAATTAGGAGGAATAGAAATAGAGCACAAGCAACAATCTTTAAAATTAACTCCAA
GAAGATAATGATTCTACTGAGTAGCTTGGAAGGATGATAGAGTTTAATTGGTGCATTTAC
GATACTAAAAAGTAAATCGTCACTGAATAGTTCTAAAGATTCATCAAGGGAGAAGATTTC
TTAGTTAATAATGAGACTCTTACCAAAAATAAAATCACTCTTAGCAAGTTCGATGGTGCA
TTGCTATTTAGCAAGCTTATTTAGGAGTTTAATGATTACACATATACTAATTTCACACGC
TAAAACAAGAGTTTCTGCATAGTCACTTACGGAGATGCTCTCATGACTAGAATCTTACCC
AGAGAAGCTTAATTTAATCAAATGAAACTTGCTTCCCACTTTTTCACTTATTTTGACATA
AGAAATGAATTCAAAAAGAATTTCTCTCATGCCATATCTATCAAAACACTACATGAAATG
TTAACATACACTAATCTCCAAGAAAAACCACTTTTAGACTAATCTATAGGGTAATTTGAA
ATGAGCAACATAGTAAGATTAGTAAATATGCTTGTAAGAAGCGGATATGTCTTCAATCAT
CCTGTAATTTAAATTTTTAAAACAACATTTTAAATTTATTAAAATTATATTCTTGACTTG
ACTTGAAAACAACATAATTGCCCTTCTTGTTTATGATTAGAAAATGATCAATTTTCAAAT
TCAAATAATATCAAGAAGAGCAGAAATTTATTTCATCAATAATTGCTAATATTTTTTATT
TATTATAAATAGAAATTGATCAATAACTCTTATCAAGTTGTGTTAGACAATTAGGACTCT
AAGACTAGATATATTCAATCAAGAGAAAAGAAGTCAAAAAATAATTATGTCAGAGGCAGA
AGCCCTGAACCATTTAAAAACCTTTCACAATAACATTTTATTCGCATAAGAGGCCTTCCT
TACTCTGCAAGAGAACCTGAAATCTACGAATTACTTAAAAATATTAGGATTTATAAAGAG
GATATTGCTTTTCTTTATGATAGCGAAGGTAAATTCTCTGGAGAAGCATATGTAAGAGTT
TACAGCTAGCTAGATAAACAAGAAGCTTTGTGCTACAATTTAAATAAGGTTGAAGGAAGA
TTTGTTGAGATTTTCGAAACTACAGAAAATGAATTTAATAGAGCTAAAATTTCTTAATTC
CCAGAAAAGAGAAATCAAGATGATGAGCTACCAAATGAAACTCAATTTGATCTCAATAAA
ATAGTCACTGAAGGAGCAGGAGTAGTAAGAATTAGAGGCTTACCCTACTCTTGTACTGAA
GAAGATATTAAAAAATTCTTTAAAGGATTAACTATTTTACAAGGAGGTAAATAAATATAC
TTTACTCATTTTTTCTTTTTTTTGTTAAAATATTATGTTTGATTTGATTAGGTATTAAGA
GAGCTATTCTTGGTGGCAGACCTGGAGGAGAGTGTTTTGTAATATTTTAAAACAAGGATG
ATGCTCATAAAGCTCTTAATTTTCATATGGAAAAAATTCACAACAGATTTATAGAAGTTT
TCTTAGCCACAGTTAAGGAATTCGAAAATTATATGGCACATAACTTTGTTAATTCTGCTC
CTGTTTATAGTAAAGATAACATGCCAAATATTCCACAAGAGAAAAGAAAATCAACTCTCA
TGGTTATGGGAATGCCTTTCAGTGTAACTAAATAAAAGATTTTAGAGTTCTTCAAAGGAT
TTGACATCAATGAAAGAGAAATACATCTTCTTTGCTCTCATACTGGCAAATTTAGTGGAT
CAGCTCTCGTTACATTCGAAGACGAGCTTGAAGCCCAAAGAGCTCTAAAAACAAAGAATT
TCTCATATATTGAAAATAGATATTTAGAATTATTTGAGTATAAATGA