Identifiers and Description

Gene Model Identifier

TTHERM_00158460

Standard Name

RRM68 (RNA recognition motif-containing protein 68)

Aliases

PreTt28436 | 13.m00395 | 3829.m01250

Description

RNA recognition motif 2 family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF04059 ) RNA recognition motif 2
  • ( PF07576 ) BRCA1-associated protein 2

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10%

TetraMine Data

TTHERM_00158460

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_05301.19.997093137033517e-262hypothetical protein (976 aa)
OxytrichaContig6775.0.g219.995739965151785e-43RNA recognition motif 2
DictyBaseDDB_G02792554.998394530072393e-19DDB_G0279255 on chromosome: 3
position 1840170 to 1845388
Stentor CoeruleusSteCoe_92381.5628821893349888e-18

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00158460(coding)
ATGGACCCACATATAGACGACGAACTCAAAGAATACTTAAGACTCATAGACGCTACAGTA
AAGTCTGCTTCTACTAACCATATTTCACCTGAAAAGGGGGCTTTTGTTTAATTTCCTCAT
CAATTTAAGACTAATGAGCTATTTTAAAATGGCATTAAATTGATAAGTAATTGCGATGAG
AAAGAATAAAAAAGCAGTCATTATCCAAAAAGAAAAAAGCCTGAAATACTCGATGATAGC
ATTGATTGGAATATTGGTTCACAATAGACTACATTGGAGTCACCTAAATCTTAAGATGAT
ATTAAAGATCTTTGTTTAGGAATTCAAAGTTTACAGTGTGGAGGTAGTGTCTAATGTGCA
TAAAGCTAGCAAAGTCAACACTTTAGCTCGTTGAATTGCATCACAGCATCCTCTTAATTC
TTTTAAAAGCTCTAACGCTTTTTCCCTGAATAGCAGCCAAACGATTAACTCAATTTAAGT
TGCCTTTGTAGTCTTGATTCTTCTTCTAAGCCTTCAAGGAATATGGTTGTCTAGCTCAGC
TAATAAGATGATATAGAATAATTCCTTGCCTTCGTTAGATCTTATGGAGATATACAAAAC
ATAGATCGCCATAAATACCAGCTTGAAAAAATAATAGTATTAAGCTTCTACAACATTCAG
TCCTCCCTGTCAGCTTTTCAGTCTATATCTTAATCGCATTCTAATAAAATGAAAGTTTCA
TATTTAAGTGATTTTAATGATTTTGATTATATAGATTACATGCTCATTTCTAATGCTAAT
AGCTTTAATTAAAAATTGGTTCTTGATTACCTTGGATGCTTTGGTAAAATTCTTGAATAC
TCAAGTATAAACAGCAAACTTGTTGTAAGATATTTTGATGTGAGATCATTAAAAGAGGTT
GATAGGATAATTAAGCTATAAGAGAAAGATAAAAAGTCCTTTATTTACTTGCATAGAACT
CATTTCCCTGAGGTAGAAGAAAAGTTTATTTTAGAGCTACTTAAGAATATTTTAATATTT
TCAAAAGAAAACACTACTGACATTATTTTGAAAAATGCAAGGGTAAAATCAGTTAAGCAA
AGTGCTTCTTAAGTTCAATAACATTAATAATAACAGTCTAATCAACAAATAGTGAAATAA
CACGAAGTAGTTATATAATAGTTAGGATTGCTTCCTACCTCGCCTAATAGCACTTCGTCT
CCAGCACTTCCTAATGCATTAGAAATAGGATATAATCAAAGATTAAATTCTCTATCTTTT
TTCAGCTCTAATAATACACATCCTATCTAGCAATAAAATATGAATAATGTTTTCAACAGT
TTCTTTAATTTTGAAGAAAACACAAATAATTAGTTCCCAGTAATATAATCTAGCAAGTAA
GATAACATTTATTAGCACACTTACTCAAACTAGAATGTACTAGGAATGACCTAAAATTTA
AATCAACAGCCTTAGTTGTATGGATATCAATAAAGAAGAGAACTTCAAGAAATAAGCGAT
TACTAAAACACATTTTAACAATCAATTTCTTAAAGCAATAAACAAAATTAATATTTATCT
TCAAATTCATCGAATTCTCTAAGCAGCTAAATTGATAACTAGTCTTTCGCTAATAATGAA
AATGAAAATATTCATATCAATAAATAATTACAACAAAAAAAATAAAAAAAGATGAACCCT
AATGTAAATAACTTTAGTTCCCTTAATTATAATAGCAACGGAAGCAATCATAATAATAAT
AACAATAGCACCAACAGTAACAGCTCATCTCTTAAACTTCTTTAAAGCAGCTATTCAGTA
AATGCAAATTGCTAACCTTAAATAAAATAAAACAATTGTTAACTGAATGTGAATTCCTTA
TAATAACCTATTTGCAATTTGTAAATGAGCTAAGAAATAGGTTCTTCTCAACAATAGATT
CAATACTTGCAGCAAATTTCACAATCTTCTTCATCTTCTCTTTCTTCTACAAACTTCCCT
CAATACAGTTAGGGACACTTCAATACTAACTTCAATTAAATGAGAAAAAGCTAAGATGAA
AATCCCTTTTCAGCTTCCTCTTTGAGAATGAGTTTTGACAATAACCAAATCTATCAAATA
AATAACAGCTTTTACCAAAATAACAACACTAACAATACCTCATAAACTAATATAAGTAAT
ATTAGTAATACTTAAAACTTAAATAACTAAATGCTCAACAGCTAAAATAATTCAGTGGCT
AATTCAATGCAAGTCCGCTTATAAAATAACTAGCAAGCATAATTTATGAATTTATTGAAT
AACAATAGCTAATTTTTAAATGAAATGTGTTTCAACAACCCTCAAAATCCAAGTATCATT
GAGCAATACGAAGCCACGTAAATTCAAAATAATTTAAGCAACTCTTCTAGCAATAGACAA
TACGCAAACACAATTAACCTACAGAATAACTATCAAACATCTCAGACTTCAAACAAGGTG
AGCACAATACTTGGAAGCAATGGAGCTAAACAATAAAATAACAACTAAAACTTCTAAGTA
AATTTAGAAAATATTGCTTCTTTTAAAGACAGACGAGCAACAGTCATGGTGAGAAATATC
CCAAACAGATATAACTAAGAAGATTTCCTAAGAATCATAGATATTAATTACAAAGGTCTT
TACGATTTCGTATACCTTCCCATGGACTTCAAAAATCATTGCAACATCGGCTATGCTTTC
ATCAATTTTATTGATCCGAAACATATAATTCCTTTCTACAATGAATTCAACGGTAAAAGG
TGGGAGATGATAAGAAGTGAAAAGGTTTGCTATATTTGCTATGCAAGGATACAAGGAAGA
AACGAGTTAATTGCTCACTTTAAAAAATCAGGAGTGATGAGCGCTTTAGTTGACAAATCA
TTTAAACCTCTAATCTTGCCAAATCCTTAGTTAGATCTCCAAATTCTTTAACAATGA


>TTHERM_00158460(protein)
MDPHIDDELKEYLRLIDATVKSASTNHISPEKGAFVQFPHQFKTNELFQNGIKLISNCDE
KEQKSSHYPKRKKPEILDDSIDWNIGSQQTTLESPKSQDDIKDLCLGIQSLQCGGSVQCA
QSQQSQHFSSLNCITASSQFFQKLQRFFPEQQPNDQLNLSCLCSLDSSSKPSRNMVVQLS
QQDDIEQFLAFVRSYGDIQNIDRHKYQLEKIIVLSFYNIQSSLSAFQSISQSHSNKMKVS
YLSDFNDFDYIDYMLISNANSFNQKLVLDYLGCFGKILEYSSINSKLVVRYFDVRSLKEV
DRIIKLQEKDKKSFIYLHRTHFPEVEEKFILELLKNILIFSKENTTDIILKNARVKSVKQ
SASQVQQHQQQQSNQQIVKQHEVVIQQLGLLPTSPNSTSSPALPNALEIGYNQRLNSLSF
FSSNNTHPIQQQNMNNVFNSFFNFEENTNNQFPVIQSSKQDNIYQHTYSNQNVLGMTQNL
NQQPQLYGYQQRRELQEISDYQNTFQQSISQSNKQNQYLSSNSSNSLSSQIDNQSFANNE
NENIHINKQLQQKKQKKMNPNVNNFSSLNYNSNGSNHNNNNNSTNSNSSSLKLLQSSYSV
NANCQPQIKQNNCQLNVNSLQQPICNLQMSQEIGSSQQQIQYLQQISQSSSSSLSSTNFP
QYSQGHFNTNFNQMRKSQDENPFSASSLRMSFDNNQIYQINNSFYQNNNTNNTSQTNISN
ISNTQNLNNQMLNSQNNSVANSMQVRLQNNQQAQFMNLLNNNSQFLNEMCFNNPQNPSII
EQYEATQIQNNLSNSSSNRQYANTINLQNNYQTSQTSNKVSTILGSNGAKQQNNNQNFQV
NLENIASFKDRRATVMVRNIPNRYNQEDFLRIIDINYKGLYDFVYLPMDFKNHCNIGYAF
INFIDPKHIIPFYNEFNGKRWEMIRSEKVCYICYARIQGRNELIAHFKKSGVMSALVDKS
FKPLILPNPQLDLQILQQ


>TTHERM_00158460(gene)
ATGGACCCACATATAGACGACGAACTCAAAGAATACTTAAGACTCATAGACGCTACAGTA
AAGTCTGCTTCTACTAACCATATTTCACCTGAAAAGGGGGCTTTTGTTTAATTTCCTCAT
CAATTTAAGACTAATGAGCTATTTTAAAATGGCATTAAATTGATAAGTAATTGCGATGAG
AAAGAATAAAAAAGGTATTTACTTTCAAATTTATTATTTAACATACCCAAAATTTTATTT
GATTTGCATGCATTTAACTATTTAAATAATGAAACAAAGCAGTCATTATCCAAAAAGAAA
AAAGCCTGAAATACTCGATGATAGCATTGATTGGAATATTGGTTCACAATAGACTACATT
GGAGTCACCTAAATCTTAAGATGATATTAAAGATCTTTGTTTAGGAATTCAAAGTTTACA
GTGTGGAGGTAGTGTCTAATGTGCATAAAGCTAGCAAAGTCAACACTTTAGCTCGTTGAA
TTGCATCACAGCATCCTCTTAATTCTTTTAAAAGCTCTAACGCTTTTTCCCTGAATAGCA
GCCAAACGATTAACTCAATTTAAGTTGCCTTTGTGTAAAAGATTTGCCTTTTTGATTGTT
ATTTCTTATATATTTGAAAATAAAGCAAAAAACACTCCCTTTCAAAAAAAAATAAACAAA
CCAAAATAAATGTTCTACTTTGCAAAATTAAATTATTAATTAATTAATTCATTTTATCAT
TTAAAATAGAGTCTTGATTCTTCTTCTAAGCCTTCAAGGAATATGGTTGTCTAGCTCAGC
TAATAAGATGATATAGAATAATTCCTTGCCTTCGTTAGATCTTATGGAGATATACAAAAC
ATAGATCGCCATAAATACCAGCTTGAAAAGTAATTGCGAAAATCATTTTTATTTGCAAAA
AATTAACTACTGAAGAGTTCTTAATCCATTTCACAATTTATATAAATAGAATAATAGTAT
TAAGCTTCTACAACATTCAGTCCTCCCTGTCAGCTTTTCAGTCTATATCTTAATCGCATT
CTAATAAAATGAAAGTTTCATATTTAAGTGATTTTAATGATTTTGATTATATAGATTACA
TGGTAATATTGATTAAACTATTTGAACTCTTTGTTTTTTATTTTTTTTCTACTTATTTAA
AGCAATATAAAAGCATATCTAATTAATTAAAGTTTTTTTTTTTTCTTCTATCCAACTTTC
TTTTTGTTAACTCTCTTTGATAATTGTTTGTCTGAACACTCACTAACATTTTTTTTATTT
GAAAAATTAATAATTTCTACTAATAATTGCGCAATTTTTACTAAAAAGTTATCATTTTTC
CATTTATTTTGCATTTTTTTATACAAATTAAATCTTTTCTTTGTTTTAGTGAAGTAAAAT
AAAATATTAGCTAAATTTCATAATAATTCATACTAAACAACATCCTTTTAAATTTTCCTT
TATCATTTAAATCAATAAATTAAAAAACCCAGTTTATTTAATTAATTAAAATTATTTAAT
TTTTGTATCAACTAAAATTTAGTGACATTGTTAAATATTGCTCATAATTTTTTACCTCAT
CTATTCAAATTTATTTATATTTTCTTTAATCAGCTTCATATAAATTATTTTTGTTAATAA
ATAGCTCATTTCTAATGCTAATAGCTTTAATTAAAAATTGGTTCTTGATTACCTTGGATG
CTTTGGTAAAATTCTTGAATACTCAAGTATAAACAGCAAACTTGTTGTAAGATATTTTGA
TGTGAGATCATTAAAAGAGGTTGATAGGATAATTAAGCTATAAGAGAAAGATAAAAAGTC
CTTTATTTACTTGCATAGAACTCATTTCCCTGAGGTAGAAGAAAAGTTTATTTTAGAGCT
ACTTAAGAATATTTTAATATTTTCAAAAGAAAACACTACTGACATTATTTTGAAAAATGC
AAGGGTAAAATCAGTTAAGCAAAGTGCTTCTTAAGTTCAATAACATTAATAATAACAGTC
TAATCAACAAATAGTGAAATAACACGAAGTAGTTATATAATAGTTAGGATTGCTTCCTAC
CTCGCCTAATAGCACTTCGTCTCCAGCACTTCCTAATGCATTAGAAATAGGATATAATCA
AAGATTAAATTCTCTATCTTTTTTCAGCTCTAATAATACACATCCTATCTAGCAATAAAA
TATGAATAATGTTTTCAACAGTTTCTTTAATTTTGAAGAAAACACAAATAATTAGTTCCC
AGTAATATAATCTAGCAAGTAAGATAACATTTATTAGCACACTTACTCAAACTAGAATGT
ACTAGGAATGACCTAAAATTTAAATCAACAGCCTTAGTTGTATGGATATCAATAAAGAAG
AGAACTTCAAGAAATAAGCGATTACTAAAACACATTTTAACAATCAATTTCTTAAAGCAA
TAAACAAAATTAATATTTATCTTCAAATTCATCGAATTCTCTAAGCAGCTAAATTGATAA
CTAGTCTTTCGCTAATAATGAAAATGAAAATATTCATATCAATAAATAATTACAACAAAA
AAAATAAAAAAAGATGAACCCTAATGTAAATAACTTTAGTTCCCTTAATTATAATAGCAA
CGGAAGCAATCATAATAATAATAACAATAGCACCAACAGTAACAGCTCATCTCTTAAACT
TCTTTAAAGCAGCTATTCAGTAAATGCAAATTGCTAACCTTAAATAAAATAAAACAATTG
TTAACTGAATGTGAATTCCTTATAATAACCTATTTGCAATTTGTAAATGAGCTAAGAAAT
AGGTTCTTCTCAACAATAGATTCAATACTTGCAGCAAATTTCACAATCTTCTTCATCTTC
TCTTTCTTCTACAAACTTCCCTCAATACAGTTAGGGACACTTCAATACTAACTTCAATTA
AATGAGAAAAAGCTAAGATGAAAATCCCTTTTCAGCTTCCTCTTTGAGAATGAGTTTTGA
CAATAACCAAATCTATCAAATAAATAACAGCTTTTACCAAAATAACAACACTAACAATAC
CTCATAAACTAATATAAGTAATATTAGTAATACTTAAAACTTAAATAACTAAATGCTCAA
CAGCTAAAATAATTCAGTGGCTAATTCAATGCAAGTCCGCTTATAAAATAACTAGCAAGC
ATAATTTATGAATTTATTGAATAACAATAGCTAATTTTTAAATGAAATGTGTTTCAACAA
CCCTCAAAATCCAAGTATCATTGAGCAATACGAAGCCACGTAAATTCAAAATAATTTAAG
CAACTCTTCTAGCAATAGACAATACGCAAACACAATTAACCTACAGAATAACTATCAAAC
ATCTCAGACTTCAAACAAGGTGAGCACAATACTTGGAAGCAATGGAGCTAAACAATAAAA
TAACAACTAAAACTTCTAAGTAAATTTAGAAAATATTGCTTCTTTTAAAGACAGACGAGC
AACAGTCATGGTGAGAAATATCCCAAACAGATATAACTAAGAAGATTTCCTAAGAATCAT
AGATATTAATTACAAAGGTCTTTACGATTTCGTATACCTTCCCATGGACTTCAAAGTAAT
TATTTATTTATTTGTATTTATTCTTAATTTTAAGAATTCTTTAACTTTTTTCTTAATTTA
ATTCCTACTTAGTAATTTCTATCAATAAAAATAAACATTAAAAATTTATTAAAATAAACA
AACAATATCAACAATATTTAAATAATAGAATCATTGCAACATCGGCTATGCTTTCATCAA
TTTTATTGATCCGAAACATATAATTCCTTTCTACAATGAATTCAACGGTAAAAGGTGGGA
GATGATAAGAAGTGAAAAGGTAATAAATTTTTAATATTAAAAATATTAAAAAATTAAATT
ATAAATTATAAAATTTAGGTTTGCTATATTTGCTATGCAAGGATACAAGGAAGAAACGAG
TTAATTGCTCACTTTAAAAAATCAGGAGTGATGAGCGCTTTAGTTGTAATAAAAATAAAT
ATTTTTAAATATTATTTTAATTTATTTTTATAATTTAATTAAAAGGACAAATCATTTAAA
CCTCTAATCTTGCCAAATCCTTAGTTAGATCTCCAAATTCTTTAACAATGA