Identifiers and Description

Gene Model Identifier

TTHERM_00703470

Standard Name

RRM67 (RNA recognition motif-containing protein 67)

Aliases

PreTt20123 | 110.m00096

Description

RNA recognition motif 2 family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF01020 ) ribosomal L40e family
  • ( PF04059 ) RNA recognition motif 2
  • ( PF04702 ) Vicilin N terminal region

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00703470

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_15307.19.997093137033517e-262RNA recognition domain-contain
ing protein 2 family protein (
1169 aa)
OxytrichaContig6775.0.g211.000159011384939e-43RNA recognition motif 2
Stentor CoeruleusSteCoe_92382.6102790696677047e-23
DictyBaseDDB_G02792559.997019043202629e-21DDB_G0279255 on chromosome: 3
position 1840170 to 1845388

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00703470(coding)
ATGTCGCAGTCTTCCAGACCGGATCAACTGAGATAGAATGTTGATTTTAATAGTGTTTTA
TTAGTGGGTTTTGATCAAATTGATCAACCAGAAGAAGGAGAACAAAATTTAAGTATTTGG
AATGATTAATTATAAAATTATAATAAAGTGGTTGATTGCTTCAACAAGTAAACTCAAGAA
AGGAATTATATGGGAAACAGCCATTTAAATAATGGAGCATAAATTGCTGCTAAGAATCGT
ATGAATTCAGGTTCAAAGCAGTATGAGAATATCCGCAGATCTAAATAAAATTAGTCTCAA
ATTCATTTGAATCAACCTATTCTCTTAAATTCTGTATAATAAAATTTTCCTATGTCTATG
CAAATGGGATAAGCAAGTTCATCATAACAGTCTTAGCTATAACAATAGAATTCTGGTACA
AATCTATAGAATTATTACTAGAATTAGACAACTGCAAAAGCATTAAATCAATCAAACACA
GCTTCAGTGACTCCTTCTTAGGCTATTTTAAGTTCAACTGCAAGAGGGTTTATGCTACAT
GCAAAAAGTAAAAAAATTAATTCAGTACAACCAAACAAAAACATATTGAGTGATTTAAAT
GAAGGAAGTACTTTAAATTAAAACGTCTAAGAAAATCAAGTTAACCAAGGAAAAAGCTAG
CAGTAGCAACCACAGTAGCTATAATAAGGTCAATAACAATAATAACAATAGTAGCAACAA
TAACAACAATAATAATAGCAGTAATAATAGTACATCAATGAAAACAGTTTTTTTCAATTT
TTTGGGGATTAATCTAAAATCAAAGCTTTAATTTAGTAACAATCTTAGCAATAATAATAG
TTACAATAATAGGTATCAGCTAATACCTAAATGAATCAAAATAATAGTGTCTTCTTTTAA
AACAAAAGGCCTAAATAATCTGATTCTACTTTTGATTCCACTTGTTCATCAACTCTTGTA
TAGGAATCTTCTTATGTTACCCCTAGAAATACAAATAAATCTTCACAAAACTCATTCATC
TAATAAGGCAATCTTCAAAATTCTCAAATATTAAATTTTAATGAAATGGGAGGATCTTGC
ACTCCTTCTTAACAATAGACTACATAATATAACAATAGCTAGAATAATCCTTAAGGAGTG
TATAGAAATAGAAATAGCATTTCTACCCATTAAGCGTATCAAAACAGTTCTAGTAATAGC
ACTACCAATAATAGTATAATAAATAATAACAATAATAATTCAATAATGTATTATGATTCT
AAAATAGCGCGCTAGTTAAGCTAGTTAAGTGTTAGCGATTACAGTTAATAATAATAATCA
TAATAGTAAAACACTGCCACGACTACACCAAGAGGTGGGAATAATAATTATTCGATGATT
TTACTTCATTATCCTCAACATTACGTCTAAGGGCAAAACAATTTTTATAACCATCATCAT
AGACATCTATCTTTCTCTAATAACTCTTCATCGCAGCAACACTCTTTCATTCTTTCATAG
TTACAGCAATCGCATATTAATTAGCATTCCTACAGCAGTAACAGCAATAACTAAAGCTTT
CAAGGAAGCTAAGCATATCATGCTTAACCTGAGATTATGTTTAGTCCTATGATTCACAAC
AAGAGCAATGATAGTATTTCATAAAATAATTGCCATCTTTCTAGCATTAACTCTTTAAAT
ACATCTTTTTAGCAAAACTACACTTCTTAGTGTTAGATTGATGATTAAAACAAATCTCGA
ACTTATAAATCTGATAGCTTGCATATCCTATAATAGCAGTAGTAATAGTAATAAAATTTT
AACGATAGCTAGAAATAAAATGGTCAGATATAAGCATCTTAATAAAGCTAATCTTAGTTT
TACTCTCAAAATTCTTAACAAAATAATACCTAAATAAGTCATCCTCAATTTTCTCCTTAA
ATTTAATAAGGAAGCTAAAGCTAGCAAAATTAAAATATTTAGTAGTAATAAAATCAGACA
AGCAACTTACTACACTATCCATAAAAGTTTTTAGCAAAACCATAAGGAATCCATAGGAAA
AATTTATCTACCTCATCGAAGACTAATGGTGGCTCATAGAATTATTCTAATATTTCTATA
TTAAACAATTAAAAATTTGAATCAGGTAGTATTCAATCTTCTAAATAAATTTAGTAGAAT
GATAATTCAATTTCAAATAATGGAAATTCTATTTAGAACAGTACGGCTATTAAATCTTAA
CAAAAAAATGATACCACAAGTTCAGCTACTTTCTCATAACTTTCAAGAAAAGTAAGAAGT
ATTACTAATAATATGATAGAATAGAGTTAAATTCTTGAAGAAGATGATGAAAAAATTGAT
GGTGAATTTTTTGATGACTCAAATAATGAATCTGAAACTGATAAGAAACAGAAATCAGAT
GATTAAACCAAAGGCAGTAAGAAAGCTGAAAAGAAAAATTCTAAAGGAACACGTAAAAGA
AAAATAATAGCTCAAGAGGAAGAAAGTAATTACTTAATCAATCCAGATAATGTAAAGTAA
GATAGTCGTACTACTGTAATGATAAAAAATATTCCAAACAAATATTCTTTACAAGCTTTA
ATGGAAAAAATTGATTAAAATCATTCAAAAACTTATGACTTTTTTTATCTTCCTATAGAT
TTTAGGAACAAATGCAACGTCGGGTATGCATTTATAAACTTCATAGATCCAGAATTTATA
AAAAATTTTTATGAAGAGTTTCATAACCAGAAGTGGGCAAAATTCAACAGTGAAAAAGTT
TGCTTGCTCTATTATGCTAGACTTCAAGGCCGTAATGCGCTTATACATCACTTTTAGCAC
TCTAGCGTCATGAATTAAAAAGATAAGAAGCTAAAGCCTGTTATACTCCCTAAAAATGAA
GTAATAGCTTTAGAATAGCTTTTAAAGAATCAAAGGGATGAAGTCCGTAAGGTATCCAAT
AGCAGTAGCTCAGCAGATCAAAGAAGCAAATCTCCTGAAAATATTAACGCATAACTTTCA
TCTAATGAATAAGAGAACTAAGCTAATACCCCAAAGCAATAATATGAAAAATCTTAAAGT
AAAGAGTCTATTTATTCAAGAGGTTCAAATCATAATTCTTCAAATCACACCTTAAAAGAT
GAGAAATGTACCATAACTTAGTCAAACGATACTCAAAATATCTAAGCTAGATCTTCAAGC
ATAAAGTCATAAACTTTACTCAATTAGACTCTAAATATATCATCTATTTCAAAAAGTATC
TCTCCAACAAATAATGAGGATATCAAACAAAAGCAAGCTCAACTCATAAAATCAAGTACT
AAAAAAGTAACTTAATGCATGAATCCTTCTTAGTAATAGTGA


>TTHERM_00703470(protein)
MSQSSRPDQLRQNVDFNSVLLVGFDQIDQPEEGEQNLSIWNDQLQNYNKVVDCFNKQTQE
RNYMGNSHLNNGAQIAAKNRMNSGSKQYENIRRSKQNQSQIHLNQPILLNSVQQNFPMSM
QMGQASSSQQSQLQQQNSGTNLQNYYQNQTTAKALNQSNTASVTPSQAILSSTARGFMLH
AKSKKINSVQPNKNILSDLNEGSTLNQNVQENQVNQGKSQQQQPQQLQQGQQQQQQQQQQ
QQQQQQQQQQYINENSFFQFFGDQSKIKALIQQQSQQQQQLQQQVSANTQMNQNNSVFFQ
NKRPKQSDSTFDSTCSSTLVQESSYVTPRNTNKSSQNSFIQQGNLQNSQILNFNEMGGSC
TPSQQQTTQYNNSQNNPQGVYRNRNSISTHQAYQNSSSNSTTNNSIINNNNNNSIMYYDS
KIARQLSQLSVSDYSQQQQSQQQNTATTTPRGGNNNYSMILLHYPQHYVQGQNNFYNHHH
RHLSFSNNSSSQQHSFILSQLQQSHINQHSYSSNSNNQSFQGSQAYHAQPEIMFSPMIHN
KSNDSISQNNCHLSSINSLNTSFQQNYTSQCQIDDQNKSRTYKSDSLHILQQQQQQQQNF
NDSQKQNGQIQASQQSQSQFYSQNSQQNNTQISHPQFSPQIQQGSQSQQNQNIQQQQNQT
SNLLHYPQKFLAKPQGIHRKNLSTSSKTNGGSQNYSNISILNNQKFESGSIQSSKQIQQN
DNSISNNGNSIQNSTAIKSQQKNDTTSSATFSQLSRKVRSITNNMIEQSQILEEDDEKID
GEFFDDSNNESETDKKQKSDDQTKGSKKAEKKNSKGTRKRKIIAQEEESNYLINPDNVKQ
DSRTTVMIKNIPNKYSLQALMEKIDQNHSKTYDFFYLPIDFRNKCNVGYAFINFIDPEFI
KNFYEEFHNQKWAKFNSEKVCLLYYARLQGRNALIHHFQHSSVMNQKDKKLKPVILPKNE
VIALEQLLKNQRDEVRKVSNSSSSADQRSKSPENINAQLSSNEQENQANTPKQQYEKSQS
KESIYSRGSNHNSSNHTLKDEKCTITQSNDTQNIQARSSSIKSQTLLNQTLNISSISKSI
SPTNNEDIKQKQAQLIKSSTKKVTQCMNPSQQQ


>TTHERM_00703470(gene)
ATGTCGCAGTCTTCCAGACCGGATCAACTGAGATAGAATGTTGATTGTAATCACGCCATT
TCTCTTTAAATATTCTTATTGTTTATACTTTTCTCTTTAACAATATGTTATTGACTTTTA
ATTAACAATAAGGAGGAAAAAATCCCTTGCTTACTTTATATTTAAAGATTGTTATTAAAC
AGAAATTTTAATGCAGAAATACCAAAATAATTCTTGTTTCAAGTGAAAAAATATTTTATC
AAACTTATTTAAGAACAGAATATAGAATTTAAAGCGAAATCTTTTTATAAAGAACCAAAT
TCATTGAATAATGAGCAAAGCATTTTTGCAAAAATTAGTTTAAAGAATGAAGGAATTTTA
AGCAATAACAACATGAATATATAAATTTATAATCAAATAAGTAGAATAAAAATGAAATAA
TTAAATTTGTTTTATATATAAATATAGTTAATAGTGTTTTATTAGTGGGTTTTGATCAAA
TTGATCAACCAGAAGAAGGAGAACAAAATTTAAGTATTTGGAATGATTAATTATAAAATT
ATAATAAAGTGGTTGATTGCTTCAACAAGTAAACTCAAGAAAGGAATTATATGGGAAACA
GCCATTTAAATAATGGAGCATAAATTGCTGCTAAGAATCGTATGAATTCAGGTTCAAAGC
AGTATGAGAATATCCGCAGATCTAAATAAAATTAGTCTCAAATTCATTTGAATCAACCTA
TTCTCTTAAATTCTGTATAATAAAATTTTCCTATGTCTATGCAAATGGGATAAGCAAGTT
CATCATAACAGTCTTAGCTATAACAATAGAATTCTGGTACAAATCTATAGAATTATTACT
AGAATTAGACAACTGCAAAAGCATTAAATCAATCAAACACAGCTTCAGTGACTCCTTCTT
AGGCTATTTTAAGTTCAACTGCAAGAGGGTTTATGCTACATGCAAGTAAAGTTTTATTAG
CATTTTTATATGTGAATTCCTATCAAATGGTTATGTATATTCACAAATTTTTATTGAAAC
ATTTTTGTCATGCTTTCTTAGAAAATTTTTTTGGAAATTTAAAAATATAATGACTTTAAT
CACCATAAATAATTAAGTAAATAATATTGATTTTTATAATACCAAAATTGATAAAAGAAT
CATAATTTAGTGAATACAATAGTAAAAAGTTGTTGTTTATTTTCTAATCACATAAACAAA
CAAATATATAAATTTTTTGTTTAAATTACATATTGATTGATAATTATATTTTTCTCAAAT
TTAATAATCTACCCAATTTAATTGATAATTAACATATTCAAAAAATTAGGATTAAATAAC
AATATAAATAATGATTTATGGTAATTAAAATAGAAAATGCTTTTTTTAGTTTTGATTGAA
AAATAAATTCAAATTTTAATTCTAATTTTTTAAAAATGATAGAAAGTAAAAAAATTAATT
CAGTACAACCAAACAAAAACATATTGAGTGATTTAAATGAAGGAAGTACTTTAAATTAAA
ACGTCTAAGAAAATCAAGTTAACCAAGGAAAAAGCTAGCAGTAGCAACCACAGTAGCTAT
AATAAGGTCAATAACAATAATAACAATAGTAGCAACAATAACAACAATAATAATAGCAGT
AATAATAGTACATCAATGAAAACAGTTTTTTTCAATTTTTTGGGGATTAATCTAAAATCA
AAGCTTTAATTTAGTAACAATCTTAGCAATAATAATAGTTACAATAATAGGTATCAGCTA
ATACCTAAATGAATCAAAATAATAGTGTCTTCTTTTAAAACAAAAGGCCTAAATAATCTG
ATTCTACTTTTGATTCCACTTGTTCATCAACTCTTGTATAGGAATCTTCTTATGTTACCC
CTAGAAATACAAATAAATCTTCACAAAACTCATTCATCTAATAAGGCAATCTTCAAAATT
CTCAAATATTAAATTTTAATGAAATGGGAGGATCTTGCACTCCTTCTTAACAATAGACTA
CATAATATAACAATAGCTAGAATAATCCTTAAGGAGTGTATAGAAATAGAAATAGCATTT
CTACCCATTAAGCGTATCAAAACAGTTCTAGTAATAGCACTACCAATAATAGTATAATAA
ATAATAACAATAATAATTCAATAATGTATTATGATTCTAAAATAGCGCGCTAGTTAAGCT
AGTTAAGTGTTAGCGATTACAGTTAATAATAATAATCATAATAGTAAAACACTGCCACGA
CTACACCAAGAGGTGGGAATAATAATTATTCGATGATTTTACTTCATTATCCTCAACATT
ACGTCTAAGGGCAAAACAATTTTTATAACCATCATCATAGACATCTATCTTTCTCTAATA
ACTCTTCATCGCAGCAACACTCTTTCATTCTTTCATAGTTACAGCAATCGCATATTAATT
AGCATTCCTACAGCAGTAACAGCAATAACTAAAGCTTTCAAGGAAGCTAAGCATATCATG
CTTAACCTGAGATTATGTTTAGTCCTATGATTCACAACAAGAGCAATGATAGTATTTCAT
AAAATAATTGCCATCTTTCTAGCATTAACTCTTTAAATACATCTTTTTAGCAAAACTACA
CTTCTTAGTGTTAGATTGATGATTAAAACAAATCTCGAACTTATAAATCTGATAGCTTGC
ATATCCTATAATAGCAGTAGTAATAGTAATAAAATTTTAACGATAGCTAGAAATAAAATG
GTCAGATATAAGCATCTTAATAAAGCTAATCTTAGTTTTACTCTCAAAATTCTTAACAAA
ATAATACCTAAATAAGTCATCCTCAATTTTCTCCTTAAATTTAATAAGGAAGCTAAAGCT
AGCAAAATTAAAATATTTAGTAGTAATAAAATCAGACAAGCAACTTACTACACTATCCAT
AAAAGTTTTTAGCAAAACCATAAGGAATCCATAGGAAAAATTTATCTACCTCATCGAAGA
CTAATGGTGGCTCATAGAATTATTCTAATATTTCTATATTAAACAATTAAAAATTTGAAT
CAGGTAGTATTCAATCTTCTAAATAAATTTAGTAGAATGATAATTCAATTTCAAATAATG
GAAATTCTATTTAGAACAGTACGGCTATTAAATCTTAACAAAAAAATGATACCACAAGTT
CAGCTACTTTCTCATAACTTTCAAGAAAAGTAAGAAGTATTACTAATAATATGATAGAAT
AGAGTTAAATTCTTGAAGAAGATGATGAAAAAATTGATGGTGAATTTTTTGATGACTCAA
ATAATGAATCTGAAACTGATAAGAAACAGAAATCAGATGATTAAACCAAAGGCAGTAAGA
AAGCTGAAAAGAAAAATTCTAAAGGAACACGTAAAAGAAAAATAATAGCTCAAGAGGAAG
AAAGTAATTACTTAATCAATCCAGATAATGTAAACAAATATTTAGATTTAAATTTATAAC
AAATTCATTTTCTTAAAAATAAAAATAGGTAAAGTAAGATAGTCGTACTACTGTAATGAT
AAAAAATATTCCAAACAAATATTCTTTACAAGCTTTAATGGAAAAAATTGATTAAAATCA
TTCAAAAACTTATGACTTTTTTTATCTTCCTATAGATTTTAGGGTAATATACAAAAGTTA
AAATTTAATAATAAAACTTAATAAAATTTTTAAAAATAAATAGAACAAATGCAACGTCGG
GTATGCATTTATAAACTTCATAGATCCAGAATTTATAAAAAATTTTTATGAAGAGTTTCA
TAACCAGAAGTGGGCAAAATTCAACAGTGAAAAAGTAAATTGCATATTTTTATGTAAACT
AATTAAATTTTTTTACTTTTTTAAATTTAGGTTTGCTTGCTCTATTATGCTAGACTTCAA
GGCCGTAATGCGCTTATACATCACTTTTAGCACTCTAGCGTCATGAATTAAAAAGTAAAA
TTTATTAAAAGTATAAAATAAAGCTAAAAAAATTTAAAAATAGGATAAGAAGCTAAAGCC
TGTTATACTCCCTAAAAATGAAGTAATAGCTTTAGAATAGCTTTTAAAGAATCAAGTAAA
ATTTATTACTATTAAATTCAAAAAAAATAAATTAAATAAATTAATTTTTAGAGGGATGAA
GTCCGTAAGGTATCCAATAGCAGTAGCTCAGCAGATCAAAGAAGCAAATCTCCTGAAAAT
ATTAACGCATAACTTTCATCTAATGAATAAGAGAACTAAGCTAATACCCCAAAGCAATAA
TATGAAAAATCTTAAAGTAAAGAGTCTATTTATTCAAGAGGTTCAAATCATAATTCTTCA
AATCACACCTTAAAAGATGAGAAATGTACCATAACTTAGTCAAACGATACTCAAAATATC
TAAGCTAGATCTTCAAGCATAAAGTCATAAACTTTACTCAATTAGACTCTAAATATATCA
TCTATTTCAAAAAGTATCTCTCCAACAAATAATGAGGATATCAAACAAAAGCAAGCTCAA
CTCATAAAATCAAGTACTAAAAAAGTAACTTAATGCATGAATCCTTCTTAGTAATAGTGA