Identifiers and Description

Gene Model Identifier

TTHERM_00502500

Standard Name

RRM66 (RNA recognition motif-containing protein 66)

Aliases

PreTt08089 | 63.m00267 | 3716.m00119

Description

RNA recognition motif-containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( TIGR01612 ) rhoptry protein
  • ( PF04059 ) RNA recognition motif 2
  • ( PF08252 ) arg-2/CPA1 leader peptide
  • ( PF00027 ) cyclic nucleotide-binding domain
  • ( TIGR00864 ) polycystin cation channel protein

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00502500

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_09562.13.9991157591502974e-89hypothetical protein (3206 aa)
OxytrichaContig6775.0.g217.998336109808381e-38RNA recognition motif 2
Stentor CoeruleusSteCoe_92385.242885663363464e-22
DictyBaseDDB_G02792551.0002869940498747e-21DDB_G0279255 on chromosome: 3
position 1840170 to 1845388

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00502500(coding)
ATGGATGGAAGTCCTAAAAGTAAAGCTGACGCGTCTTCTTCTTTGCAAAATTAATAATCT
CAATTAACATAATCCTAGCAAGCTTAAAAAATTTATCAAAGCGAAAGTGGAAATTACAAA
TAGATAGTTTAAAAAAATAGCTCTGAAAATTAAAAATTAATGGATGATTAAACTGATAAA
AATGTGAACAGCATTGGAATATAGGAATTTGATAATAAAATTTGTCAATAACAAATAACA
GACAAAAAAATACTGAACGAAGTATCTTAAAACTAGGAAATCCAATTAAATAATATCAAA
AGCAGTAGAAGCAGTTCAAACAATTCTTAAATTGCAGGAAATGTTATAAATAGTATAAGC
TATGAACCATAAAACGGAAAAAATAATTGTAATAGCTAAAGTGTTAGTAGCAATTCCAAC
AATCAATCTTAAGATATCCATATTAGCAATCATGTGTTTGAAAGCAAGAATCACTCTTCT
AATTGTTCAAGAAATGATTAATTAAACTAAGATTTACAAAAAAAGCTATCTGCTAGTAGT
GATTCAGGGATTTAAAACGTTTTTGAAGATTAAAGCAAGAATTAAGTAGTATGTAACATG
GCTCAATCAGCTATTTTATTTGATTAAAACTCTTTGGAAAGAAAAGAATAAAATTAAAAT
ACATTAAAGCAATAAAACTTATAAGCTGAAAACGCAAGTATGTCTTCTTCTTCATAACAG
TAATTTTTATAGCCTGACCAGTAATTGAATTAGTATCATCGATATCATAGAAATTAATTT
AATTATGCACTAAATCGTAGGAGTCACAGCTAATCTAGGGAGTAAGATTTTGAAGAAAGT
GCATCTTCTTCATCATTCTCTAAATCATCAACTAAAAAAGCTGTTGGCGAAGTCACTACT
GGGTTAGTAGTTAATGGAAATAGCAACAATTAAATGAATTTAAATATTACAACTTAGAAT
TAAAATCAAAATAGCAACAACAACAGTAATAGCAGCAATAATAATAGTGATGTTAATAAT
AAGAACACTGCAAACAATAATTTTTTTGTTAACATTGCAAATGTTTCTACAGATTAATAC
ACAAGAAGTAGTAGTAGCACAGCAGATAAAAAGAAAGTATTACGTTAAAAGATGTTTGAT
GTATCATTGTTAAATTTTTTTGTGAGACAATAATCCCAAAATAATAGTTCAAAAAGTTCT
AAAAATAATAGTAATATGTCTTCAAACGATTCTCACGACAACAATAGTGGTCCTAACAGC
AGAGTAATTAATGAGAAAAAAATCAAGGAAAACAAGTAGACATCAACTACTTCAACGACA
CGCGCATAGATTTTATATGGACCAACAAAAGAAGAGTTAAATCAGAAATTAATGGAACCT
GTCGGTCACCGCCGTACAATTTCATCTAATTTGCACTAACATAGTTAAGCTTGCTCCTCC
TCTGGCTCTTCACTATCATCAACTAACAATTATTCATAAAATCAAAAGCAAAGCTTAAAC
TTAAATTAAAACTTATTTAATTCGTTTGGCCCTATTTAAAAGCAAGAATCTTCGACTTAT
TCCCACTTTTAAACTCCAGTTTATTCTTAAAAACTTCTTCATTTTTACAATGAAAGTTCA
TCTTCATCATCTTCTGCAGATAATCAGCAATCTTTCATCCAACAGAGTAAAAAGAAAATA
TCCTAGCCTTTCTGTTCTATTGGAGGAGATATTAACAATAATAGTTGTGATCAAAAAGAT
GAAATGATTTAGTTCGAAAAGTAGTTTTAAGATATTATACCTAATTCTAAATAGATTACT
GAACCTTAAAATAATAGCTCATTAGTTTAAAATAGCTCTGTTTAAAACAATAAGTTACCA
ACAGTTGTAACGGAAGTAGAAGATACTGAGGACGATGATTATGCAAATGCTTTCTAAGAA
TGGTCTGTAAATATCTCTCCCTAAGCATCAAATTCTATTAAAAAAGCTCCTTTATCACCA
GATTTTTTAATTGCAAATTAAGATTTTAGTTTATAATATCCCTAAACTCATCATTAGTAA
TAAATTTTAAATTTAAATGAAAACTTTGATGATATTTAGAAAGAAATTAACTAGTAAAAT
CTTCAAAAGCAAATTCAAAATTTTGAAGAAAAAAATGAAAGTGATAATTTTATAAACTAA
TTACAAAAACCTCATACTCAATAATAACAACAGTAGCAAAACCAAATAAATATACTATCA
CATTCTCATATTTTAGATTAAAGAATGGAGGATAATAAATATTAGCCTTTATAACATAGT
ATGTTTTATGAACATCAAATTCATTAATTATAATAGCAGCAGTAGTAGTAAGATAATACA
GAAAATGTACTATACTATTAGGATTAAAATTTTAGAATTCAAAATATAATTTTATAGTAG
CAGTAGCAATTTCTTGTAAAGTAACCTCAAAACTAGCAAATGCAGTAAAATGTAATAGGT
TTACCTTTATCTTAACCTGATTAACAGGCTAATATATTTTTCCCTGCATCAAATGCAAGT
GAGAAATTTTAAGCTTAATTTCATACAGGGTCTCTAATCCTACCTCCTTAGTAAAGCGAG
ATAAATAATATTATAAGTAGTCCTTCTGTAATGAATTAAAGCTTACAAATTTCAACTCCT
CCTAGTAATTTTAGCAATTAGTCTAAACACATAGAAAGCAAAAAGTAATACTAAATTGGT
GATTTAACTCCTCGTGAAGGCTATAATACTCTTAGTACAAATCCTTCAAGCAAGAAGAGC
GTATGCATGAAATCGCCTAAAGAAGATAACTTCTTTACAACTTCTAGTGCCTCCTCAACA
AATAAGATAATTAGTAAAAATACAAATATACATTCTACAGCTGTTACTGATGAAAGTTTA
ATTGACAATATTAACTAGCAGTACCCAACAATTTCAAATACAGAATTAGGGATGATGTAA
AAAAATTAGTATTTTACTTCTCAAATTCCTATAACACCTCAATTGAATAATTAAATTAAT
ATTAATCCTCTGATTTATCCCACATAAGTTTACTTGAGTGATGAAAAAATGTAATATCAA
CAATCTATCTTAAATAACCCATCAGGATAAAAAATGAAAACGCAACCTAACCCTCAAACA
TCATCTTCATCCTAATACTCCTCTAATAGTACAAGTTAGTATAACTTTACTCCTTCAAAT
ATGGGTTTTAAGAATTAGCTAGAAAATATTCATCTCATTGGTACAAATATTCAGAATGGG
TTAAGAAGCAGCGAGTGCTATCCTTAATCACCTTCACCAAATTTAGATTTTTTAAATTAA
AGAAAAAGTTTGCATGTAAGTAGCTCAACAGGATCTAATTATTTTAGTGATTAAAAGTAA
ATAATTCCCTAGGTTTTGAACTTTTAGATAACATAGCATAATCAGCCAAATTTATAATAG
ACATCATCTAATCAGCACTCAAATTCAAGTGAGCCTAATAGTCTTATTAACTAACATCAA
TATGGTAGTGGTATTCATTTAAAAACTAGTGAGTCTACTGATTTTAGTAATTAATCTTTA
CCTTAATTTTAAAATATGTCTTCTTCTATTTCAAGCATGCAAGCTCAATAATAAAAGAAT
TAACAAATTTACGGTAATTAGAATTAAAATAATTAGAAAAATGGATTATAAAAACCAGAA
ATAATATCATAAGCTTCTTCATCATCTAATTCATCTATAAATTCATCATAACAGCAGCAA
GTTTATTAGCAGAAGAAAATATCTAATCAATTTTAATAGCAGAATAGTAATGATTAGACA
TCTAATTCATAATAATTTTAATTGAACAATAGTAAATAGCAATTCATACCGAAGAAAAAT
TTTAGCTAAATTAATCAAATAAACTTTTAAAACGCCTCTTTAAATAGCAACAACAGCAGT
GGAAGTAACTAAAACAATAGCAGTATTAACAATTAAAATAATAATATAACAATAAATAAT
AGCTAGTAAATCCATTACCCTAACCATCATAAGAGATAATAATCATAAACTAGCCAAAGT
GGATAAAAGCAGAATCCTACTTAAATGCAATAAAATTGTTTTTAAAAACCATAATATTAG
CAGCAAAAGATGGACCCGAAATAAAATAACCAATAAATAAGTTAGAATAATATGAGAAAT
TCTCAATAGGAAATAAAAAGTAAACCTATGAATAATATTTCACAACAGTAATAGTAATAA
CATTAAAACTAAAAAATTAATTAAAAGAATAATAACAATAATAATAACAACAACAATAAT
AATAGCACGATTAAAAATAATACCATAAATATGAATTAAAATAATATTGTAAATAATCTC
AATAATAGTAACATCAATAGTCTAAATAACAACAATCCTAATAACAAACAACAAGGAGGA
AGACACAGACATACAGTTTCAGAATCTTCAACTGAATATAAAATAGATTTGAAAAGAATA
AATGAAGATGGCAGAACAACTTTGATGATAAAAAATATACCAAATAAATATGAACAAGAT
CTACTTCTATAAACTATTGATAGGAAGCATAAGCATACTTACGATTTCTTTTATCTACCT
ATTGATTTTACAAATAATTGTAATGTTGGGTATGCATTTATAAATTTCAAAGAAACTAGG
TTTATTGAGCCTTTTTATAGAGAATTTAATGACTAAAAATGGAAAAAATATAATTCTGAT
AAAATTTGCTAGCTTTGTTATGCAAGAATTCAAGGAAGTGAAAGTTTAAATAATCACTTT
AGATCATCATCAGTTATGAATTAAAAAGATAACAAATATAAACCCCTATTTATAGATACT
AAAGATAAATCAGCTATATAACAAATTGTTGATTAACAAAAAAAAGATATAGAAAAAGAA
AAGAAATGA


>TTHERM_00502500(protein)
MDGSPKSKADASSSLQNQQSQLTQSQQAQKIYQSESGNYKQIVQKNSSENQKLMDDQTDK
NVNSIGIQEFDNKICQQQITDKKILNEVSQNQEIQLNNIKSSRSSSNNSQIAGNVINSIS
YEPQNGKNNCNSQSVSSNSNNQSQDIHISNHVFESKNHSSNCSRNDQLNQDLQKKLSASS
DSGIQNVFEDQSKNQVVCNMAQSAILFDQNSLERKEQNQNTLKQQNLQAENASMSSSSQQ
QFLQPDQQLNQYHRYHRNQFNYALNRRSHSQSREQDFEESASSSSFSKSSTKKAVGEVTT
GLVVNGNSNNQMNLNITTQNQNQNSNNNSNSSNNNSDVNNKNTANNNFFVNIANVSTDQY
TRSSSSTADKKKVLRQKMFDVSLLNFFVRQQSQNNSSKSSKNNSNMSSNDSHDNNSGPNS
RVINEKKIKENKQTSTTSTTRAQILYGPTKEELNQKLMEPVGHRRTISSNLHQHSQACSS
SGSSLSSTNNYSQNQKQSLNLNQNLFNSFGPIQKQESSTYSHFQTPVYSQKLLHFYNESS
SSSSSADNQQSFIQQSKKKISQPFCSIGGDINNNSCDQKDEMIQFEKQFQDIIPNSKQIT
EPQNNSSLVQNSSVQNNKLPTVVTEVEDTEDDDYANAFQEWSVNISPQASNSIKKAPLSP
DFLIANQDFSLQYPQTHHQQQILNLNENFDDIQKEINQQNLQKQIQNFEEKNESDNFINQ
LQKPHTQQQQQQQNQINILSHSHILDQRMEDNKYQPLQHSMFYEHQIHQLQQQQQQQDNT
ENVLYYQDQNFRIQNIILQQQQQFLVKQPQNQQMQQNVIGLPLSQPDQQANIFFPASNAS
EKFQAQFHTGSLILPPQQSEINNIISSPSVMNQSLQISTPPSNFSNQSKHIESKKQYQIG
DLTPREGYNTLSTNPSSKKSVCMKSPKEDNFFTTSSASSTNKIISKNTNIHSTAVTDESL
IDNINQQYPTISNTELGMMQKNQYFTSQIPITPQLNNQININPLIYPTQVYLSDEKMQYQ
QSILNNPSGQKMKTQPNPQTSSSSQYSSNSTSQYNFTPSNMGFKNQLENIHLIGTNIQNG
LRSSECYPQSPSPNLDFLNQRKSLHVSSSTGSNYFSDQKQIIPQVLNFQITQHNQPNLQQ
TSSNQHSNSSEPNSLINQHQYGSGIHLKTSESTDFSNQSLPQFQNMSSSISSMQAQQQKN
QQIYGNQNQNNQKNGLQKPEIISQASSSSNSSINSSQQQQVYQQKKISNQFQQQNSNDQT
SNSQQFQLNNSKQQFIPKKNFSQINQINFQNASLNSNNSSGSNQNNSSINNQNNNITINN
SQQIHYPNHHKRQQSQTSQSGQKQNPTQMQQNCFQKPQYQQQKMDPKQNNQQISQNNMRN
SQQEIKSKPMNNISQQQQQQHQNQKINQKNNNNNNNNNNNNSTIKNNTINMNQNNIVNNL
NNSNINSLNNNNPNNKQQGGRHRHTVSESSTEYKIDLKRINEDGRTTLMIKNIPNKYEQD
LLLQTIDRKHKHTYDFFYLPIDFTNNCNVGYAFINFKETRFIEPFYREFNDQKWKKYNSD
KICQLCYARIQGSESLNNHFRSSSVMNQKDNKYKPLFIDTKDKSAIQQIVDQQKKDIEKE
KK


>TTHERM_00502500(gene)
ATGGATGGAAGTCCTAAAAGTAAAGCTGACGCGTCTTCTTCTTTGCAAAATTAATAATCT
CAATTAACATAATCCTAGCAAGCTTAAAAAATTTATCAAAGCGAAAGTGGAAATTACAAA
TAGATAGTTTAAAAAAATAGCTCTGAAAATTAAAAATTAATGGATGATTAAACTGATAAA
AATGTGAACAGCATTGGAATATAGGAATTTGATAATAAAATTTGTCAATAACAAATAACA
GACAAAAAAATACTGAACGAAGTATCTTAAAACTAGGAAATCCAATTAAATAATATCAAA
AGCAGTAGAAGCAGTTCAAACAATTCTTAAATTGCAGGAAATGTTATAAATAGTATAAGC
TATGAACCATAAAACGGAAAAAATAATTGTAATAGCTAAAGTGTTAGTAGCAATTCCAAC
AATCAATCTTAAGATATCCATATTAGCAATCATGTGTTTGAAAGCAAGAATCACTCTTCT
AATTGTTCAAGAAATGATTAATTAAACTAAGATTTACAAAAAAAGCTATCTGCTAGTAGT
GATTCAGGGATTTAAAACGTTTTTGAAGATTAAAGCAAGAATTAAGTAGTATGTAACATG
GCTCAATCAGCTATTTTATTTGATTAAAACTCTTTGGAAAGAAAAGAATAAAATTAAAAT
ACATTAAAGCAATAAAACTTATAAGCTGAAAACGCAAGTATGTCTTCTTCTTCATAACAG
TAATTTTTATAGCCTGACCAGTAATTGAATTAGTATCATCGATATCATAGAAATTAATTT
AATTATGCACTAAATCGTAGGAGTCACAGCTAATCTAGGGAGTAAGATTTTGAAGAAAGT
GCATCTTCTTCATCATTCTCTAAATCATCAACTAAAAAAGCTGTTGGCGAAGTCACTACT
GGGTTAGTAGTTAATGGAAATAGCAACAATTAAATGAATTTAAATATTACAACTTAGAAT
TAAAATCAAAATAGCAACAACAACAGTAATAGCAGCAATAATAATAGTGATGTTAATAAT
AAGAACACTGCAAACAATAATTTTTTTGTTAACATTGCAAATGTTTCTACAGATTAATAC
ACAAGAAGTAGTAGTAGCACAGCAGATAAAAAGAAAGTATTACGTTAAAAGATGTTTGAT
GTATCATTGTTAAATTTTTTTGTGAGACAATAATCCCAAAATAATAGTTCAAAAAGTTCT
AAAAATAATAGTAATATGTCTTCAAACGATTCTCACGACAACAATAGTGGTCCTAACAGC
AGAGTAATTAATGAGAAAAAAATCAAGGAAAACAAGTAGACATCAACTACTTCAACGACA
CGCGCATAGATTTTATATGGACCAACAAAAGAAGAGTTAAATCAGAAATTAATGGAACCT
GTCGGTCACCGCCGTACAATTTCATCTAATTTGCACTAACATAGTTAAGCTTGCTCCTCC
TCTGGCTCTTCACTATCATCAACTAACAATTATTCATAAAATCAAAAGCAAAGCTTAAAC
TTAAATTAAAACTTATTTAATTCGTTTGGCCCTATTTAAAAGCAAGAATCTTCGACTTAT
TCCCACTTTTAAACTCCAGTTTATTCTTAAAAACTTCTTCATTTTTACAATGAAAGTTCA
TCTTCATCATCTTCTGCAGATAATCAGCAATCTTTCATCCAACAGAGTAAAAAGAAAATA
TCCTAGCCTTTCTGTTCTATTGGAGGAGATATTAACAATAATAGTTGTGATCAAAAAGAT
GAAATGATTTAGTTCGAAAAGTAGTTTTAAGATATTATACCTAATTCTAAATAGATTACT
GAACCTTAAAATAATAGCTCATTAGTTTAAAATAGCTCTGTTTAAAACAATAAGTTACCA
ACAGTTGTAACGGAAGTAGAAGATACTGAGGACGATGATTATGCAAATGCTTTCTAAGAA
TGGTCTGTAAATATCTCTCCCTAAGCATCAAATTCTATTAAAAAAGCTCCTTTATCACCA
GATTTTTTAATTGCAAATTAAGATTTTAGTTTATAATATCCCTAAACTCATCATTAGTAA
TAAATTTTAAATTTAAATGAAAACTTTGATGATATTTAGAAAGAAATTAACTAGTAAAAT
CTTCAAAAGCAAATTCAAAATTTTGAAGAAAAAAATGAAAGTGATAATTTTATAAACTAA
TTACAAAAACCTCATACTCAATAATAACAACAGTAGCAAAACCAAATAAATATACTATCA
CATTCTCATATTTTAGATTAAAGAATGGAGGATAATAAATATTAGCCTTTATAACATAGT
ATGTTTTATGAACATCAAATTCATTAATTATAATAGCAGCAGTAGTAGTAAGATAATACA
GAAAATGTACTATACTATTAGGATTAAAATTTTAGAATTCAAAATATAATTTTATAGTAG
CAGTAGCAATTTCTTGTAAAGTAACCTCAAAACTAGCAAATGCAGTAAAATGTAATAGGT
TTACCTTTATCTTAACCTGATTAACAGGCTAATATATTTTTCCCTGCATCAAATGCAAGT
GAGAAATTTTAAGCTTAATTTCATACAGGGTCTCTAATCCTACCTCCTTAGTAAAGCGAG
ATAAATAATATTATAAGTAGTCCTTCTGTAATGAATTAAAGCTTACAAATTTCAACTCCT
CCTAGTAATTTTAGCAATTAGTCTAAACACATAGAAAGCAAAAAGTAATACTAAATTGGT
GATTTAACTCCTCGTGAAGGCTATAATACTCTTAGTACAAGTAATAATTTTTAAAAATTA
CTGTAAATAGCAATTTTATATAAGAAAATATCCTTTATTAAAAGGGAATTAATTATAGCA
AGCATATTGAAATTTTTTTAAGCTTAAATCGTAATAAATTATTAAAAATTAAATTAAAAT
AAAAGATCCTTCAAGCAAGAAGAGCGTATGCATGAAATCGCCTAAAGAAGATAACTTCTT
TACAACTTCTAGTGCCTCCTCAACAAATAAGATAATTAGTAAAAATACAAATATACATTC
TACAGCTGTTACTGATGAAAGTTTAATTGACAATGTAATCAATTTATTTAAATTTTTTTT
ACTTTAGAATTTATTTTTATTAAATTTTTGCAACTTTTATTGTTAAAAAAATTGATTAAA
TAAACAATTTTGGAATTAGCATTTGAATCTGTAAAAATTAAGTTTTTAATTTTAAAATAA
TATCAACTTTAAATAATTCACAATTTATTGTTAACAAACTATCTATTTTACCCAAAAAAA
TTAAATGGGCATAACTTATTAATTATTAATTAAAATCATTCAATTGTTTTTCTCAATTAA
GAAAATTTATTGGGTAATCAAATAAATTTTATCAAATTCAATATCTAATAAAATTTATTT
TGCCAAACAAGATATTTTTTTAATTAGTTAACTAAATTCAATCAAGCATAATTCTTATCC
CCTTTATTAATTAAATTCTAATTTTAATTGTCATTCTAATTTTTTCATATAAATAAAACA
ATACTTATAGAAGACTTCCACACATTAAATAAATTAATTAATTAATTTTTTTATTTACTT
ATATAATTTTAAATGTAAGATTAACTAGCAGTACCCAACAATTTCAAATACAGAATTAGG
GATGATGTAAAAAAATTAGTATTTTACTTCTCAAATTCCTATAACACCTCAATTGAATAA
TTAAATTAATATTAATCCTCTGATTTATCCCACATAAGTTTACTTGAGTGATGAAAAAAT
GTAATATCAACAATCTATCTTAAATAACCCATCAGGATAAAAAATGAAAACGCAACCTAA
CCCTCAAACATCATCTTCATCCTAATACTCCTCTAATAGTACAAGTTAGTATAACTTTAC
TCCTTCAAATATGGGTTTTAAGAATTAGCTAGAAAATATTCATCTCATTGGTACAAATAT
TCAGAATGGGTTAAGAAGCAGCGAGTGCTATCCTTAATCACCTTCACCAAATTTAGATTT
TTTAAATTAAAGAAAAAGTTTGCATGTAAGTAGCTCAACAGGATCTAATTATTTTAGTGA
TTAAAAGTAAATAATTCCCTAGGTTTTGAACTTTTAGATAACATAGCATAATCAGCCAAA
TTTATAATAGACATCATCTAATCAGCACTCAAATTCAAGTGAGCCTAATAGTCTTATTAA
CTAACATCAATATGGTAGTGGTATTCATTTAAAAACTAGTGAGTCTACTGATTTTAGTAA
TTAATCTTTACCTTAATTTTAAAATATGTCTTCTTCTATTTCAAGCATGCAAGCTCAATA
ATAAAAGAATTAACAAATTTACGGTAATTAGAATTAAAATAATTAGAAAAATGGATTATA
AAAACCAGAAATAATATCATAAGCTTCTTCATCATCTAATTCATCTATAAATTCATCATA
ACAGCAGCAAGTTTATTAGCAGAAGAAAATATCTAATCAATTTTAATAGCAGAATAGTAA
TGATTAGACATCTAATTCATAATAATTTTAATTGAACAATAGTAAATAGCAATTCATACC
GAAGAAAAATTTTAGCTAAATTAATCAAATAAACTTTTAAAACGCCTCTTTAAATAGCAA
CAACAGCAGTGGAAGTAACTAAAACAATAGCAGTATTAACAATTAAAATAATAATATAAC
AATAAATAATAGCTAGTAAATCCATTACCCTAACCATCATAAGAGATAATAATCATAAAC
TAGCCAAAGTGGATAAAAGCAGAATCCTACTTAAATGCAATAAAATTGTTTTTAAAAACC
ATAATATTAGCAGCAAAAGATGGACCCGAAATAAAATAACCAATAAATAAGTTAGAATAA
TATGAGAAATTCTCAATAGGAAATAAAAAGTAAACCTATGAATAATATTTCACAACAGTA
ATAGTAATAACATTAAAACTAAAAAATTAATTAAAAGAATAATAACAATAATAATAACAA
CAACAATAATAATAGCACGATTAAAAATAATACCATAAATATGAATTAAAATAATATTGT
AAATAATCTCAATAATAGTAACATCAATAGTCTAAATAACAACAATCCTAATAACAAGTA
AATTAAAATATAAGATCAAAGGTATTTAAATTTACATATTAAAATAAATAAATAGACAAC
AAGGAGGAAGACACAGACATACAGTTTCAGAATCTTCAACTGAATATAAAATAGATTTGA
AAAGAGTAATTAATTTTTTTGCATTTTTGTTTGTTGTTTGATGGGTTTTGATAATATAAT
CTAGATAAATGAAGATGGCAGAACAACTTTGATGATAAAAAATATACCAAATAAATATGA
ACAAGATCTACTTCTATAAACTATTGATAGGAAGCATAAGCATACTTACGATTTCTTTTA
TCTACCTATTGATTTTACAGTAAATAGAATTATCAAATTTAATTTTTCTAACTGCCTAAA
ATTTTTAGTTTTCTAAATACTTATTTATTTATTTAATTATTTATTTTTAAAAACTAAGAA
TAATTGTAATGTTGGGTATGCATTTATAAATTTCAAAGAAACTAGGTTTATTGAGCCTTT
TTATAGAGAATTTAATGACTAAAAATGGAAAAAATATAATTCTGATAAAGTAAGTTATTG
AATATTTGTATAAAAAATAATAAATAAAATCTTACTTAAAAAAAGATTTGCTAGCTTTGT
TATGCAAGAATTCAAGGAAGTGAAAGTTTAAATAATCACTTTAGATCATCATCAGTTATG
AATTAAAAAGTATGAAACCTTATTTAATAAATTTTTCAGCTAATTTTGTATATTTATCAA
CAGGATAACAAATATAAACCCCTATTTATAGATACTAAAGATAAATCAGCTATATAACAA
ATTGTTGATTAACAAGTAAATATCTAATTTAATGAGTAAGATTAAATCATTTAATAATTT
ATTTTATTTTAGAAAAAAGATATAGAAAAAGAAAAGAAATGA