Identifiers and Description

Gene Model Identifier

TTHERM_00023920

Standard Name

RRM65 (RNA recognition motif-containing protein 65)

Aliases

PreTt12005 | 1.m01053

Description

RNA recognition motif-containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF01480 ) PWI domain
  • ( PF02755 ) RPEL repeat
  • ( PF08729 ) Histone promoter control 2 (HPC2)
  • ( PF04394 ) Protein of unknown function, DUF536
  • ( PF00076 ) RNA recognition motif. (a.k.a. RRM,

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 11%

TetraMine Data

TTHERM_00023920

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_13860.19.997093137033517e-262hypothetical protein (722 aa)
OxytrichaContig11888.0.g72.000620012690291e-23PWI domain
WormBaseWBGene000122450.00000000000004998767099442072status:Partially_confirmed U
niProt:H2L2D0 protein_id:CCE
72034.1
DictyBaseDDB_G02699260.00000000000009996062864481225DDB_G0269926 on chromosome: 1
position 3880004 to 3882178
Stentor CoeruleusSteCoe_8190.0000000000002543665647376923
SGDYER165W0.000000100009565553302PAB1 Poly(A) binding protein,
part of the 3-end RNA-processi
ng complex, mediates interacti
ons between the 5 cap structur
e and the 3 mRNA poly(A) tail,
involved in control of poly(A
) tail length, interacts with
translation factor eIF-4G

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00023920(coding)
ATGAGCGACATGAATAATATGATGCGTATGCCTGGATAGCCTCCAAATGGCATGCCTATG
CAACCACCTATGAATTTAAACCCACAAATGATTCCAGGACAAATGGTGCCTCCTCCATTT
ATGGGACCAGGAAATTAGCCAATGAGACAAATGCCAATGAACAACCAATAGCCTCCTATG
TTTCCTCCACAACAAATTCCAGGAATGCCACCATTTCCTCATCACATGGGTCATCCTCCC
CCTCATGGAATGATGAACTAATTTTAGTAGTTCCCCCCAATGAACTAAATGCCTAACATG
CCTCCTTTTCAACCACCAAATTTTTAAGTGCCACCTCCTATGATGGGCCAACAACCTCAA
ATTTAAGTAGCTCCCTCAATTCATGCACCTCCTCTTTTAAATAATGCACCTTAAAACCCT
AATATGATTAGAGAAACTATTACTGGCGGGCCCTCTGCAATCCCTTCATCTTCTGCTCCC
CCCTCTAACACCTCCTCTTCAGACTCCCAATGGCTTAAATTATTCGTTAATAACATTCAT
CCAGACGTGCCTGACGAGTTCATCAAAAAGTTATTAGAAGAATGTGGTCAAGTAGAAAAG
TGGAAAAGGTAGAGTGATGAAAAAGGTAATTTAAATAAATTTGGTATTGTAGAATATAAA
ATGTTCGAAAGTGTTCTTAAGTGCATACGTATTCTTGATGGCTTTGAAATTATGGACGAA
AAACTTGTTGTTAAGTCCTCATAAACAACTTAAACTTTCATAGAGTAATGGAAATAGCTC
AAAAGCAAAAAATGGGAGGAAGAATAAAAGTAGAAAGCATCTACTGAGTTTGAATCTTTT
GACTAGTTCCTTGAAAAGGATGACTCTGTCATTAGAGAAAGAATCGAATTGCACATGAAG
AGCATAGATGAAAAAGTTGAGAAAGTAAGAGAAAAAAAGAGAGAAGACGAAGAAAAAAAA
CTTCATCCTCGTGAAAAGGATAGAGATAATAAAAAGAAGTAGTAATAAAGAGAAATTGAA
AAGAAAGGTAAAGAAAAATTAAAAGAATGGTTGCAGGTAGAAGAAGACATGGCCCGTGAA
AAAAGAAAAGAAAGGGAAAGAGAAAAAGAGCGTGATAGAATTCGTCAAAAGGCTCTAGAA
AGGGAATTAACTTATACTGATGACATTGACCGTCACAAACAAAGGGGCAGAATGATGGAG
CGCAAGAGATAACGCCAAAGAGAATTGGAGGAAGATGAAAATGATAGAAAAAAAGAATTA
GAACTACTTAATCCTCCTGAGCCTGAATTTAACATTCCTATGCCTGAAGAGCCATTAGAT
GATTATGAACCATCAAGCAGTAATGGAATAAATGGATAACATAATCACACCGATAAAATT
GATAGAGGAGTGATTAACTTAAACTTTGAAGAAATCGATTTAAGTCAAAGTAAAAAGCCA
AATGAAGAAGTCATTGAATATACTATAGAAAATCCTAGAAATAACATAATTAACCAAACA
ATCAATAAGCTAAATATTTAATTCAAGTAAGATTTTAGTGATAAAATTTAAAAAGGCGAA
TATGTTATGCCTGCAATGGAAGAAGAATATTAAGAGCCTGTTGCAAATATTAATGAATAC
CACTCATCTCGTGCAATGTAAATAGAATCTGATAATAAAGATCCCTCTATCAAGTAAATC
TTTGGAAACTTAGACGAAGAAGAAGAGGAAGAAAGACAAAGAAACCTCAGAAAAACTGAG
CTTCCTAAAATTGGACATGCTCGTTTCGTCGAGTAAAGAGAAATTATTCGTAAACAGTAA
AATGAGTCTGGAGAAGAAAAAACTCCTGCTCCAAGACAATTATCTGAAGAAGAAATGAAA
AAAGAACTTAAAGAAATCCTCTAGCGTGTACCACCTATTAGCGGCAACAACTCAGCTTTG
TTCTCATTCAATTTTAATTGGGAATTATTTGAAAAGAGTGGACTACTTGATAAGAAAATA
AAACCTTTCCTTTTAAAGAAGAGTTAAGAACTTTTGGGTTAGGAAGAATAAGGATTCGTT
GATCTTATAGTTAAGAAGTTTACTCAAAGACCAACCCCAGAAAAATTGGTTAGATAGATT
GTGAAAATTTTGGATGAAGACGAATCTGAGAAGTTTATAGCATCACTTTGGAGAATTATG
ATCTTTGAGACACTAAAATATGAAAAATTCTTGCACATTGTCTGA


>TTHERM_00023920(protein)
MSDMNNMMRMPGQPPNGMPMQPPMNLNPQMIPGQMVPPPFMGPGNQPMRQMPMNNQQPPM
FPPQQIPGMPPFPHHMGHPPPHGMMNQFQQFPPMNQMPNMPPFQPPNFQVPPPMMGQQPQ
IQVAPSIHAPPLLNNAPQNPNMIRETITGGPSAIPSSSAPPSNTSSSDSQWLKLFVNNIH
PDVPDEFIKKLLEECGQVEKWKRQSDEKGNLNKFGIVEYKMFESVLKCIRILDGFEIMDE
KLVVKSSQTTQTFIEQWKQLKSKKWEEEQKQKASTEFESFDQFLEKDDSVIRERIELHMK
SIDEKVEKVREKKREDEEKKLHPREKDRDNKKKQQQREIEKKGKEKLKEWLQVEEDMARE
KRKEREREKERDRIRQKALERELTYTDDIDRHKQRGRMMERKRQRQRELEEDENDRKKEL
ELLNPPEPEFNIPMPEEPLDDYEPSSSNGINGQHNHTDKIDRGVINLNFEEIDLSQSKKP
NEEVIEYTIENPRNNIINQTINKLNIQFKQDFSDKIQKGEYVMPAMEEEYQEPVANINEY
HSSRAMQIESDNKDPSIKQIFGNLDEEEEEERQRNLRKTELPKIGHARFVEQREIIRKQQ
NESGEEKTPAPRQLSEEEMKKELKEILQRVPPISGNNSALFSFNFNWELFEKSGLLDKKI
KPFLLKKSQELLGQEEQGFVDLIVKKFTQRPTPEKLVRQIVKILDEDESEKFIASLWRIM
IFETLKYEKFLHIV


>TTHERM_00023920(gene)
ATGAGCGACATGAATAATATGATGCGTATGCCTGGATAGCCTCCAAATGGCATGCCTATG
CAACCACCTATGAATTTAAACCCACAAATGATTCCAGGTTTAAAATAAATTAATTGATTT
TAAATTACAATTATTGATCATATTCTAATAAAATTAGGACAAATGGTGCCTCCTCCATTT
ATGGGACCAGGAAATTAGCGTAATAATTTAAGAATAGAATATTAAAATTTCAAATTAAAT
CATTTCAATTACAATTTCGAATTCTAAAATGCTAAAAATAATTTAATTTTCTTTATAATA
ATATTTAAAAAAGCAATGAGACAAATGCCAATGAACAGTAATATAAGCTATTTTCTCGCA
ATAGTATCAAATTTTAATAATCTTTTTCATTATTTAGACCAATAGCCTCCTATGTTTCCT
CCACAACAAATTCCAGGAATGCCACCATTTCCTCATCACAGTAATTAATAATTAAATAAA
TAAATAGATAAAATTTACTTCATTGATTATTTGTAGGTTCTTTAAATCTATTTGATATCT
TTAATAGCTAGCAAAATAACAAGGAGCCAAGTATTTATAATAATAATCAATAAATACAAA
TATGAAATTTAAGATAAATTTACTCATAAAATCTCAACAAATAAATAATTGAAAATAAAA
AAATGTTAGAAAAAGAATAAATTATATTTAAAATTGTTAACAAATAATTGCATATTAATA
TATAAATTGTATAAAAAGTGGGTCATCCTCCCCCTCATGGAATGATGAACTAATTTTAGT
AGTTCCCCCCAATGAACTAAATGCCTAACATGCCTCCTTTTCAACCACCAAATTTTTAAG
TGCCACCTCCTATGATGGGCCAACAACCTCAAATTTAAGTAGCTCCCTCAATTCATGCAC
CTCCTCTTTTAAATAATGCACCTTAAAACCCTAATATGATTAGAGAAACTATTACTGGCG
GGCCCTCTGCAATCCCTTCATCTTCTGCTCCCCCCTCTAACACCTCCTCTTCAGACTCCC
AATGGCTTAAATTATTCGTTAATAACATTCATCCAGACGTGCCTGACGAGTTCATCAAAA
AGTTATTAGAAGTAAAAAAGATTAACTTAAACAAATTTATATTAATTAAAAATAGGATTG
AAAATCTAAGTTTAGTTTTTTTTGAATTGATTGTGTAAAGATTTAAAATCACTAGTTTGC
AAACTATTAAAAACAAGCAAACAAAAAATAAACATTCACAGTTAAAACATACTTTAAAGC
ACTGCTGCTTGAATCGAGAGCAGATACAGTAAATATAAATAAGTAGATATCAATTCATAA
GTGCTAACATTTTATTTTATTTTCTAAATAATCAATTAGCCTTTAGCGATTACGATTATT
CTCAATCGCTTTTTTGGACATATATTTATTTGTTATAAACACCAACCATTCAAGCAAGCA
AATAATCAATCAATCATGTTAGTTAGTTCGTATTAAAATGATTAGTAGTAAAATTTTTAT
TTCTATTTGAATGATAATTAATATCAAGTATACTTTTGAAATTAAGAAAGATTCAATGAA
ATTTGATTTGAAACAATGAATGAATTATATTATTTGAACTGTGGTGGTAAATGTTAATTA
AACTCTCAGCAAAATATAAAAGATTTAATCTAATTTTTTTCCTAGAAATTATTTATATTG
ATTTTTTAAAAACAAACGCTAAGCTTCATTCATATCTTTTTTTAAAAAACAGGAATGTGG
TCAAGTAGAAAAGTGGAAAAGGTAGAGTGATGAAAAAGGTAATTTAAATAAATTTGGTAT
TGTAGAATATAAAATGTTCGAAAGTGTTCTTAAGTGCATACGTATTCTTGATGGCTTTGA
AATTATGGACGAAAAACTTGTTGTTAAGTCCTCATAAACAACTTAAACTTTCATAGAGTA
ATGGAAATAGCTCAAAAGCAAAAAATGGGAGGAAGAATAAAAGTAGAAAGCATCTACTGA
GTTTGAATCTTTTGACTAGTTCCTTGAAAAGGATGACTCTGTCATTAGAGAAAGAATCGA
ATTGCACATGAAGAGCATAGATGTAATTTATTTATTTTTTTACTCTTTATTCAACAAATT
TCTTCTTTTTTTGTTTTCTTGAATAATTTTTTAACGGTTTTAAATAGGAAAAAGTTGAGA
AAGTAAGAGAAAAAAAGAGAGAAGACGAAGAAAAAAAACTTCATCCTCGTGAAAAGGATA
GAGATAATAAAAAGAAGTAGTAATAAAGAGAAATTGAAAAGAAAGGTAAAGAAAAATTAA
AAGAATGGTTGCAGGTAGAAGAAGACATGGCCCGTGAAAAAAGAAAAGAAAGGGAAAGAG
AAAAAGAGCGTGATAGAATTCGTCAAAAGGCTCTAGAAAGGGAATTAACTTATACTGATG
ACATTGACCGTCACAAACAAAGGGGCAGAATGATGGAGCGCAAGAGATAACGCCAAAGAG
AATTGGAGGAAGATGAAAATGATAGAAAAAAAGAATTAGAACTACTTAATCCTCCTGAGC
CTGAATTTAACATTCCTATGCCTGAAGAGCCATTAGATGATTATGAACCATCAAGCAGTA
ATGGAATAAATGGATAACATAATCACACCGATAAAATTGATAGAGGAGTGATTAACTTAA
ACTTTGAAGAAATCGATTTAAGTCAAAGTAAAAAGCCAAATGAAGAAGTCATTGAATATA
CTATAGAAAATCCTAGAAATAACATAATTAACCAAACAATCAATAAGCTAAATATTTAAT
TCAAGTAAGATTTTAGTGATAAAATTTAAAAAGGCGAATATGTTATGCCTGCAATGGAAG
AAGAATATTAAGAGCCTGTTGCAAATATTAATGAATACCACTCATCTCGTGCAATGTAAA
TAGAATCTGATAATAAAGATCCCTCTATCAAGTAAATCTTTGGAAACTTAGACGAAGAAG
AAGAGGAAGAAAGACAAAGAAACCTCAGAAAAACTGAGCTTCCTAAAATTGGACATGCTC
GTTTCGTCGAGTAAAGAGAAATTATTCGTAAACAGTAAAATGAGTCTGGAGAAGAAAAAA
CTCCTGCTCCAAGACAATTATCTGAAGAAGAAATGAAAAAAGAACTTAAAGAAATCCTCT
AGCGTGTACCACCTATTAGCGGCAACAACTCAGCTTTGTTCTCATTCAATTTTAATTGGG
AATTATTTGAAAAGGTAATTTTTATTTTAAAATAGCTTTAACATTCAAATGTTATATTAA
AATAAATATGGCAAAATACAATAAAACTCTAATGAATAAAATATATTTGATTAAAAGTGA
AATATTTCACCATCATTTTTGAATAAATTATTAAATTCATAATAAAGTATAAAAAAAGAC
ATTAATAAACGAATTAAATTCATTAAAAAAATTGTATAAAAATTATATAAAATTAAATTA
ATAAAAAAATAATTTAAAATTAGAGTGGACTACTTGATAAGAAAATAAAACCTTTCCTTT
TAAAGAAGAGTTAAGAACTTTTGGGTTAGGAAGAATAAGGATTCGTTGATCTTATAGTTA
AGAAGTTTACTCAAAGACCAACCCCAGAAAAATTGGTTAGATAGATTGTGAAAATTTTGG
ATGAAGACGAATCTGAGAAGTTTATAGCATCACTTTGGAGAATTATGATCTTTGAGACAC
TAAAATATGAAAAATTCTTGCACATTGTCTGA