Identifiers and Description

Gene Model Identifier

TTHERM_00581500

Standard Name

RRM64 (RNA recognition motif-containing protein 64)

Aliases

PreTt25593 | 79.m00107 | 3827.m00821

Description

polyadenylate-binding protein 2

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.9%

TetraMine Data

TTHERM_00581500

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_07384.12.000234809436283e-103polyadenylate-binding protein
2 (182 aa)
WormBaseWBGene000039041.9991095569230066e-20locus:pabp-2 status:Confirme
d UniProt:Q93233 protein_i
d:CAB02750.1
OxytrichaContig4061.0.g906.998542127613979e-20RNA recognition motif_ (a_k_a_
RRM, RBD, or RNP domain)
DictyBaseDDB_G02773712.000769134519826e-18pabpn1 on chromosome: 2 positi
on 7899822 to 7900713
SGDYIR001C4.999617891954556e-16SGN1 Cytoplasmic RNA-binding p
rotein, contains an RNA recogn
ition motif (RRM); may have a
role in mRNA translation, as s
uggested by genetic interactio
ns with genes encoding protein
s involved in translational in
itiation
Stentor CoeruleusSteCoe_122720.00000000000003442477108469977

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00581500(coding)
ATGTCTGAAAAGGAATAGGATAGAGAAGATTAGGAGCTTTTAAATTAGTTCCAAGAAGAT
GAGGAAGAACTATAGCAAGAAGAGGAAGGCGAAGAAGAAGGTGTAGCCACCAACGATGCT
TCCGACAGTAAAGAGAAAAATGATGAAATAATTCAACAAAAAGAAGAAGATAAAAGATCG
ATATTTGTTTAAAATGTAGAGTATAATACAACCAAGGAAGAATTAATGGATATCTTTAAG
GACTGCGGAGAAATCGAAAAAATCACTATACCACAAACCAGATAAGGCTAAGGAAAGGGG
TTTGCATATATCCAATTTGTAGATAAAAGTTCTGTTGAGCTAGCAAAAGCTTTAAGTGAT
TCTATTCATAGAGGTAGAGCAATCAAGGTTTTACCAAAGAGGACAAATCAACATGGCTTT
AAAAAGAAAAGCTTTAAGCCAAACGGATTTAGTAAATCATTCCCTTACATGAAAAATAGC
ATAATGAAGGGATTCATGTTTGGAGGAGCTGGTTATTACAAAAAAAAATTCAATCCTCAT
TGA


>TTHERM_00581500(protein)
MSEKEQDREDQELLNQFQEDEEELQQEEEGEEEGVATNDASDSKEKNDEIIQQKEEDKRS
IFVQNVEYNTTKEELMDIFKDCGEIEKITIPQTRQGQGKGFAYIQFVDKSSVELAKALSD
SIHRGRAIKVLPKRTNQHGFKKKSFKPNGFSKSFPYMKNSIMKGFMFGGAGYYKKKFNPH


>TTHERM_00581500(gene)
ATGTCTGAAAAGGAATAGGATAGAGAAGATTAGGAGCTTTTAAATTAGTTCCAAGAAGAT
GAGGAAGAACTATAGCAAGAAGAGGAAGGCGAAGAAGAAGGTGTAGCCACCAACGATGCT
TCCGACAGTAAAGAGAAAAATGGTACTTAATAGATTCTTAAAAATATTTCAAATAAATCA
TTTCACATCAACTTAATAAATTAAATTATCTCATTAATTTATGATTACGAGATTTATTAT
TGAACAAAGTCTTGAATAGCATGAATTTAGAGCAAAAACAAAATCATTATTAAATAAGAG
TTTCAATGAAGATTAAGAATGATGAAATATTTGAAATAAAGATGGACAATTAATTGAGAT
TTACTAATTATTTTAATAATAAAAATAACAGATGAAATAATTCAACAAAAAGAAGAAGAT
AAAAGATCGATATTTGTTTAAAATGTAGAGTATAATACAACCAAGGAAGAATTAATGGAT
ATCTTTAAGGACTGCGGAGAAATCGAAAAAATCACTATACCACAAACCAGATAAGGCTAA
GGAAAGGGGTAACAATCAAACAAACAAATAAACAACAACAACAACAAAATTAAACTATAA
AGTTTTTTGAAATGAAGAAATAAGATAAGAAAATAAAGAACTTATAGCTATTTCATTGAT
TTTAAAATTTATGATATCTTTTGTAATTTAGGTTTGCATATATCCAATTTGTAGATAAAA
GTTCTGTTGAGCTAGCAAAAGCTTTAAGTGATTCTATTCATAGAGGTAGAGCAATCAAGG
TAAATATATAATAAGATTTTATCTTTTACACAACAATTTCATTCATTCACTCACTCACTT
ATTAGCTCTGTTCTGCATATTTTTCTAAAATAAATTCACATGTTTGAATTTTAAAAAAAG
GTTTTACCAAAGAGGACAAATCAACATGGCTTTAAAAAGAAAAGCTTTAAGCCAAACGGA
TTTAGTAAATCATTCCCTTACAGTAATTATAATTTGGTTTATAATTAAGTCTCTAAATAG
AATTTTTTTAAATAGTGAAAAATAGCATAATGAAGGGATTCATGTTTGGAGGAGCTGGTT
ATTACAAAAAAAAATTCAATCCTCATTGA