Identifiers and Description

Gene Model Identifier

TTHERM_00023990

Standard Name

RRM63 (RNA recognition motif-containing protein 65)

Aliases

PreTt12012 | 1.m01060

Description

Splicing factor 3B subunit 4

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF08199 ) Bacteriophage E2-like protein
  • ( TIGR01661 ) ELAV/HuD family splicing factor
  • ( TIGR01622 ) splicing factor, CC1-like family
  • ( TIGR01659 ) sex-lethal family splicing factor
  • ( PF00076 ) RNA recognition motif. (a.k.a. RRM,
  • ( TIGR01628 ) polyadenylate binding protein, human types

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.2%

TetraMine Data

TTHERM_00023990

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_13866.13.999324360634196e-166splicing factor 3B subunit 4 (
326 aa)
OxytrichaContig15452.0.g396.001435805040647e-94RNA recognition motif_ (a_k_a_
RRM, RBD, or RNP domain)
WormBaseWBGene000047238.995576032080571e-85locus:sap-49 Splicing factor
3B subunit 4 status:Confirm
ed UniProt:Q09442 protein_
id:CAB60993.2
DictyBaseDDB_G02677141.0004249259458435e-52sf3b4 on chromosome: 1 positio
n 676187 to 677352
Stentor CoeruleusSteCoe_1834.0795586671775603e-41
SGDYOR319W4.001714826231863e-32HSH49 U2-snRNP associated spli
cing factor with similarity to
the mammalian splicing factor
SAP49; proposed to function a
s a U2-snRNP assembly factor a
long with Hsh155p and binding
partner Cus1p; contains two RN
A recognition motifs (RRM)

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00023990(coding)
ATGAATTTTAATATATCAGAAAGAAATTCTGATGCCACTCTCTATGTAGGTGGTTTAGAT
TAGAAAGTCACTTAAGAAGTTTTATGGGAATTATTTTCTTAATGCGGTATAGTAATCAAC
GTACATTTACCTAGAGATAAAATCACTGGAGAGCATTAGGGTTATGGATTCGTTGAATAT
AAAACAGAAGAAGATGCAGATTATGCTATCAAAATTTTGCATTTAATTAAGTTGTATGGA
AAACCTATAAAAGTAAACAAAGCATCCTAAGATAAAAGAACCTAGGAAGTTGGTGCTAAT
ATATTTATTGGAAATTTAGATCCTTCAGTTACAGAGATGTAGTTATAGGAAACATTTTCT
ACTTTTGGTCTCATCATTGGCCGTAGAATTGTTCGTGATTCTGACAATAACTAATCTAAA
GGGTATGCTTTTATTTCTTATGATAATTTCGAATCCTCTGATAATGCTATATCTGCAATG
AACGGTTAATATTATGGAAGTTAAAAAATTAGTGTTTAATATGCCTTTAAGAAAGACTCT
AAAGGAGAAAGACATGGTTCTGCTGCAGAAAGACTTCTTGCTGCAAACAGACCTCAACCT
TTGTAGTCAGGTATGGGTATGAACGCACCTGCCCCTCTTGTCCCAAGCAACAAGGGTATC
AATAGATCATCGATTCCTATGGCAGAAGGATTAATATAGCCTAATCCTATTGTTCCTCAA
AATGCATATGCTTAACCTCCTAACTTTGCTCCTCCTATGCCAGGTTATAACATGCCCCCA
AATATGCCACCTAACATGCCTCCTCCTCCAATGTATATGCCTCAATAAATGCCCCCTGGT
TATCCTCCTCTTCCTCCAAATATGCCCCCTCCTCCTATGGGTATGCCTCCTCTTCCTCCA
GGTTAGTACATGCCTCCTCCTCCAGGTTTTATGCCTCCAAACATGCCAAACTTGCCAATA
CCCCCAAGACTTAATTGA


>TTHERM_00023990(protein)
MNFNISERNSDATLYVGGLDQKVTQEVLWELFSQCGIVINVHLPRDKITGEHQGYGFVEY
KTEEDADYAIKILHLIKLYGKPIKVNKASQDKRTQEVGANIFIGNLDPSVTEMQLQETFS
TFGLIIGRRIVRDSDNNQSKGYAFISYDNFESSDNAISAMNGQYYGSQKISVQYAFKKDS
KGERHGSAAERLLAANRPQPLQSGMGMNAPAPLVPSNKGINRSSIPMAEGLIQPNPIVPQ
NAYAQPPNFAPPMPGYNMPPNMPPNMPPPPMYMPQQMPPGYPPLPPNMPPPPMGMPPLPP
GQYMPPPPGFMPPNMPNLPIPPRLN


>TTHERM_00023990(gene)
TATTATTTAATTAATTAAATAAGTAGCAATATAATATTAATTTATCTTAGTCACTTACTT
ATATTTAATTTAAAGATGAATTTTAATATATCAGAAAGAAATTCTGATGCCACTCTCTAT
GTAGGTGGTTTAGATTAGAAAGTCACTTAAGAAGTTTTATGGGAATTATTTTCTTAATGC
GGTATAGTAATCAACGTACATTTACCTAGAGATAAAATCACTGGAGAGCATTAGGTAATT
GCAGATATATTTAATTTTTATTAGCTTAAAATGTCATTGAAACTTTTAAATTCAAGCAAA
ATTTATAAAATAAACTTAAAAGCATTCAATAATTATTATTTTAGCATGTTAAAGTATAAT
GAAAAGTTAAGAAACCATCAATAATTAAGATAATTTAAGATAGAAATGATATCATTTATT
TAAACTTTTGTTAGAAATTAGTTCAAGCTTCAAAAATGCATAATTGAATTCAAGGAATAT
TTACAATTCTATAAAAAATAAACACTTTAAAGAAAGCCTATTAAGAATATAAAATATAAT
TTTAGCTATCATAATATCAGCATTTTCATTTTCAATTTTAGATTTTGCTTTTATTTAAAA
AGTTATTTTAAAAATTATCGAATAGACGCTGTTTCTTATATAAATTAAATTGAAATCTAA
TTATGTTATGCAATGCTAAAATTGAAAATAAATAAAAAATAATAGATATATTAATCAAAT
ATTTTTATATAAATCAAATTAACAATTATTTTATTTTTTTTAAAAGGGTTATGGATTCGT
TGAATATAAAACAGAAGAAGATGCAGATTATGCTATCAAAATTTTGCATTTAATTAAGTT
GTATGGAAAACCTATAAAAGTAAACAAAGCATCCTAAGATAAAAGAACCTAGGAAGTTGG
TGCTAATATATTTATTGGAAATTTAGATCCTTCAGTTACAGAGATGTAGTTATAGGAAAC
ATTTTCTACTTTTGGTCTCATCATTGGCCGTAGAGTAATAAATAATTCAAATATATAAAT
AAGACACTAAGTTACTATTTTTATCAAAAATCTAAAATCATCAAGCTGTATAATTCTTCT
CTAAAAGATTGCTTAGCAAATAGCTAAAAAAATTTCAATCAGAAAAATAAAAAGCAAAAA
TTTGACACTAGAAATTAAATATAAAATGATTTTTGCACATGCCTTTATTTTCATTTGAGG
AGTAGGAATAAAATAATTAATTCTAAATTTAAAGCAATAATATCTAAATTTTTAAATAGT
CTCAAAAGCAATTTACTTGCCATAAAAGATGATTTAAATAAAATCAAGTTGAAATTCTTT
GAATAATTCACACTCTTACCAATAAAATAATATTAAATTTTACTTAAATCATTTTTATAA
ACACAACAATTACTTATGTTGAACTTACCTTAATACTAATAAAAATATAAACAAATTTAA
AATGACAAGAATAAAATTATCTGTTTGATTGAAATATTAAAATAGTTAATATTTATGAAC
GAAAAAAATTCATGAATATCTAACTTTCTATACTTTAGAGGAAATCAAGAAATATTTATT
TATTTTATTTTATTAGAGAAATAATTTTTATTAAAAATAATCAACATTTTAATGAAAATA
ATTTTTATTTGATAAAAAGATTGTTCGTGATTCTGACAATAACTAATCTAAAGGGTATGC
TTTTATTTCTTATGATAATTTCGAATCCTCTGATAATGCTATATCTGCAATGAACGGTAA
ATAAATCTGATTTTATACTGTGAATATTTATAAACTTTAAAATTTTTAATTAGGTTAATA
TTATGGAAGTTAAAAAATTAGTGTTTAATATGCCTTTAAGAAAGACTCTAAAGGAGAAAG
ACATGGTTCTGCTGCAGGTAAAATTAACTAAATACATTTAATTTTAAAAAACTTTTTTGC
AATTGCTTCTTAATTTAATGAGTTTTTTAACAACCAAATTTTAATTTAATAGAAAGACTT
CTTGCTGCAAACAGACCTCAACCTTTGTAGTCAGGTATGGGTATGAACGCACCTGCCCCT
CTTGTCCCAAGCAACAAGGGTATCAATAGATCATCGATTCCGTAAATAAAAAATATATCA
TAATTTAGATTTTTAATTTTTAAAGATTAAAATAAATTTTTTTATTTTTAAACAAATAGT
ATGGCAGAAGGATTAATATAGCCTAATCCTATTGTTCCTCAAAATGCATATGCTTAACCT
CCTAACTTTGCTCCTCCTATGCCAGGTTATAACATGCCCCCAAATATGCCACCTAACATG
CCTCCTCCTCCAATGTATATGCCTCAATAAATGCCCCCTGGTTATCCTCCTCTTCCTCCA
AATATGCCCCCTCCTCCTATGGGTATGCCTCCTCTTCCTCCAGGTTAGTACATGCCTCCT
CCTCCAGGTTTTATGCGTAATAAAATGAAATTATTTAGCTATTTAACAAATATAAATTTT
TTTTGAATAAATAAATAGCTCCAAACATGCCAAACTTGCCAATACCCCCAAGACTTAATT
GA