Identifiers and Description

Gene Model Identifier

TTHERM_00649100

Standard Name

RRM62 (RNA recognition motif-containing protein 62)

Aliases

PreTt09224 | 94.m00142 | 3677.m00050

Description

RNA recognition motif-containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Domains

  • ( PF08648 ) Protein of unknown function (DUF1777)
  • ( PF00642 ) Zinc finger C-x8-C-x5-C-x3-H type (and

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 12.8%

TetraMine Data

TTHERM_00649100

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_17866.19.997316819378982e-180zinc finger protein (330 aa)
OxytrichaContig706.0.g821.0003926095686843e-81Zinc finger C-x8-C-x5-C-x3-H t
ype (and similar)
DictyBaseDDB_G02850779.997652352281279e-57u2af1 on chromosome: 4 positio
n 2799520 to 2801698
WormBaseWBGene000066988.000462645699572e-47locus:uaf-2 status:Confirmed
UniProt:Q9U2U0 protein_id
:CAB55137.1
Stentor CoeruleusSteCoe_334252.4426007377405277e-36

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00649100(coding)
ATGTTTGATTTTTTATTTGTTTGTTTCTTTGAGAGGGGAAAGAAAAAAGAGAAAAGAGAA
AAATATTAATATAATTATTTAATAATCAAAGAAAAGTAAAGAGAAAAGACTTAAATCTTA
GAAAAGCGGTAGAAAAAGGAAGTCTATAGACAATATCTAAATAAACTAAGTTAAGGTATA
AATTTTAGTTAGCTAGCTTATTAGTAAAGGAAAGCAAAGAAAGCAAGTAAGGTAGTAAAA
GTTAGTTAGTAGTAGAAGTAGTAAGGTTAATAGTAAAAGTAAGTAAATAAGTAAGTTTAA
GTTTTAGAAATGGCTGAGAAATTAAGTCGTATGTATGGTACAGAAGAAGACAAGGTCAAT
TGTCCCTTCTACTTTAAAATTGGTGCTTGCAGATATGAAAATAAATGTCTCAGAATCCAC
AACAGACCCTCTGAGAGTTAGACTATCTTGATTAAGCACATGTACTAGAACTCCCCCACT
GAGTTGGCTTTGGCTTAGGGTAATAGAGTCAGCGAAGAAGAAGCTTAGAAGGCTTTGAAT
CACTACGAAGAATTTTATGAGGAAGTCTTTTTGGAGTTAGCAAGTTACGGAGAAATTGAT
GACTTGATCATTTGTGATAACATCGGTGATCACATGAAAGGAAACGTTTACGTTAAATAT
GTTAGGGAAAGCGAAGCTCTTAAGTGCTTGATGTCCTTAAAGACTCGTTATTACGACAAG
CAACAGCTCCAACCTGAATTCTCTCCCGTTACTGATTTCTCTAATGCAAAATGCAAACAA
TATATTGAAGGTCAGTGCAAAAGAAGTGGATACTGTAATTACATTCACTCTAAGCCTATC
GGTAGACCATTCAGAAGATCCCTTTTCAGATAAATGTACGAAGAGCATCCTGAATACAAG
AACAGGTCTCGCTCTCGCTCTAGATCAGATGATGATGAGAGATCTAAAAAGAAAAGAAAG
GATAAGGAAAGATCTGAAAAACATGAAAAAGACTCCAAAAAGAAGCATTCTCGTTCCAGA
AGCTCCCATAAAAAGCACAAGAAAGATAAAGATAAAAAGAAGAAGAAGTCTAGATCTCAC
TCCAAGCATTCTAAGTCAGCTTCTCCTGGCTACAAAAACTCTGAAGAAAGAAGAGCTGAT
ATCGCAAAGTGGGGCGAGGAAGATGATGAAGAAGACATGAAAGTCAATGCAAGCGGTTCA
GTCAACAATAATGGAACCACCAGCAATAACGAATAAAGCGACAGCAATAACAAGCAAGGC
ACTCACGATTATTTAGCCTAGCTTGTTAAGCCATAGAATTGA


>TTHERM_00649100(protein)
MFDFLFVCFFERGKKKEKREKYQYNYLIIKEKQREKTQILEKRQKKEVYRQYLNKLSQGI
NFSQLAYQQRKAKKASKVVKVSQQQKQQGQQQKQVNKQVQVLEMAEKLSRMYGTEEDKVN
CPFYFKIGACRYENKCLRIHNRPSESQTILIKHMYQNSPTELALAQGNRVSEEEAQKALN
HYEEFYEEVFLELASYGEIDDLIICDNIGDHMKGNVYVKYVRESEALKCLMSLKTRYYDK
QQLQPEFSPVTDFSNAKCKQYIEGQCKRSGYCNYIHSKPIGRPFRRSLFRQMYEEHPEYK
NRSRSRSRSDDDERSKKKRKDKERSEKHEKDSKKKHSRSRSSHKKHKKDKDKKKKKSRSH
SKHSKSASPGYKNSEERRADIAKWGEEDDEEDMKVNASGSVNNNGTTSNNEQSDSNNKQG
THDYLAQLVKPQN


>TTHERM_00649100(gene)
TTGCTTATTTGGATGTTTGATTTTTTATTTGTTTGTTTCTTTGAGAGGGGAAAGAAAAAA
GAGAAAAGAGAAAAATATTAATATAATTATTTAATAATCAAAGAAAAGTAAAGAGAAAAG
ACTTAAATCTTAGAAAAGCGGTAGAAAAAGGAAGTCTATAGACAATATCTAAATAAACTA
AGTTAAGGTATAAATTTTAGTTAGCTAGCTTATTAGTAAAGGAAAGCAAAGAAAGCAAGT
AAGGTAGTAAAAGTTAGTTAGTAGTAGAAGTAGTAAGGTTAATAGTAAAAGTAAGTAAAT
AAGTAAGTTTAAGTTTTAGAAATGGCTGAGAAATTAAGTCGTATGTATGGTACAGAAGAA
GACAAGGTCAATTGTCCCTTCTACTTTAAAATTGGTGCTTGCAGATATGAAAATAAATGT
CTCAGAATCCACAACAGACCCTCTGAGAGTTAGACTATCTTGATTAAGCACATGTACTAG
AACTCCCCCACTGAGTTGGCTTTGGCTTAGGGTAATAGAGTCAGCGAAGAAGAAGCTTAG
AAGGCTTTGAATCACTACGAAGAATTTTATGAGGAAGTCTTTTTGGAGTTAGCAAGTTAC
GGAGAAATTGATGACTTGATCATTTGTGATAACATCGGTGATCACATGAAAGGAAACGTT
TACGTTAAATATGTTAGGGAAAGCGAAGCTCTTAAGTGCTTGATGTCCTTAAAGACTCGT
TATTACGACAAGCAACAGCTCCAACCTGAATTCTCTCCCGTTACTGATTTCTCTAATGCA
AAATGCAAACAATATATTGAAGGTCAGTGCAAAAGAAGTGGATACTGTAATTACATTCAC
TCTAAGCCTATCGGTAGACCATTCAGAAGATCCCTTTTCAGATAAATGTACGAAGAGCAT
CCTGAATACAAGAACAGGTCTCGCTCTCGCTCTAGATCAGATGATGATGAGAGATCTAAA
AAGAAAAGAAAGGATAAGGAAAGATCTGAAAAACATGAAAAAGACTCCAAAAAGAAGCAT
TCTCGTTCCAGAAGCTCCCATAAAAAGCACAAGAAAGATAAAGATAAAAAGAAGAAGAAG
TCTAGATCTCACTCCAAGCATTCTAAGTCAGCTTCTCCTGGCTACAAAAACTCTGAAGAA
AGAAGAGCTGATATCGCAAAGTGGGGCGAGGAAGATGATGAAGAAGACATGAAAGTCAAT
GCAAGCGGTTCAGTCAACAATAATGGAACCACCAGCAATAACGAATAAAGCGACAGCAAT
AACAAGCAAGGCACTCACGATTATTTAGCCTAGCTTGTTAAGCCATAGAATTGATTTCAC
TATATAGAATTAATTAATTAATTACAAAATAAATCAATCAAGGCTGATTTGGAGATACAG
TTGAAGATAAACCAAGAGAACACAAGATAGAACTGACTGCTAAGTAATTAAAAACCAATC
AAACCACAATAAAGTAAGCAAAATCTAACTAAGCAAAGCAAATAAAAAGAAGAAAATAAG
GAAAAAGAAATGAATGTATGTCTCTTTAATAAGTATATTATATATATAGTAAATAAATCA
ATTAAGCAACAACATCAACAAATAAGCAAGCAATCAAGCTAGCTAGCTAGTTAGAGATCC
TGGCAATAAGAACAATTAATATAAAAACAATAGAAGCGATAGCGGACTATGGAAGGAAAC
AATTTAACTAAAATGTTACCTGCCATTTGTTTGCAGTTTCGCGTTATTTTTTATTTTCAT
ATATTAATCAAATAATCTAGCAAGGGTATATCAATCAATCAAACAAACAAACAATCTCCA
TCAAGTTTTATTGTTTTATTTATCTTTTTATTATATTTTATAAAGCAAATCTATTTTAGT
TCGTTCTGTAGTCTTTAATTAATTAATACAAGTTATTCTTATTTAGCTCTCTCTTTAACG
AAGATAGCGTATTTTTTCATTAGTTAGTTAGGAGCTTAGAAAGTAAGTTCTCCGCGGAAA
CCAACAAAAAAAACATTTATTATTTCTTTCAATAAAAGCAAGGTTAGGGCAACGCTAGTT
AAATAAATAAACAAATATACAAATTAATTAATTTATTAGTTAATTTGCATTTAGCAAGCA
AAAAGCAAAGCATTTTTAGTTACTTTTTCCCTTTTTTTAGCAAGCAAGCAATTGATATTT
AGCCATCATCCATTACCCATACACACACAAAAATTCTCTTAATTGAGAAAAAAAGAAACA
AAATTTAGCGTAGACACATTCACCTACCCACCAACCATTTTAAGAGAAGAGCTTCATTAT
TTATTTATTCAAATAATCTTTAAACACGCATCAAATATTATTTCAAACCAAGTTTTCTTT
GTTTTATAGCTTAAAAAAGTATAGTAAAGCCTAAAAAGCATGATTAAATCACAATTTATT
TTAATTTATTATTTCTAAATATCAATTTTATAAAATTCAACTCATCAAACAATTAAAAAA
TTTTTTATTTTTAACAATTCTTTATTATTCATCATTTCAATTAATTAATATTATTATGAT
AAAATATCTACTAAAGAAAGAAAATTAAATAATAAAATTATAAAAGCACAAAACCTATAT
ATGTATCTATTAATCAACTTAAATTTTGTTTAAAATATATTCATTTAAAATAAAATAAAT
GAATGCTAAAATTATAAAATTAAAAAAAAAAAATTATAAATATTTAAATTTTTATTTAAT
ATGTAAATTAAATACAAATCATTA