Identifiers and Description

Gene Model Identifier

TTHERM_00047170

Standard Name

RRM61 (RNA recognition motif-containing protein 61)

Aliases

PreTt11196 | 3.m01877 | 3824.m02955

Description

RNA recognition motif-containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 14%

TetraMine Data

TTHERM_00047170

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_01741.12.0004037638327014e-151hypothetical protein (295 aa)
OxytrichaContig17921.0.g782.99915080840225e-45RNA recognition motif_ (a_k_a_
RRM, RBD, or RNP domain)
DictyBaseDDB_G02754599.995317835403734e-19DDB_G0275459 on chromosome: 2
position 6113524 to 6114624
WormBaseWBGene000086880.00000000000003999587784428659status:Confirmed UniProt:Q95
QL3 protein_id:CAC70081.1
SGDYGR159C0.00000000000003999587784428659NSR1 Nucleolar protein that bi
nds nuclear localization seque
nces, required for pre-rRNA pr
ocessing and ribosome biogenes
is

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00047170(coding)
ATGAATGAAGCAAAACAATTAGTAAACAAAGTATCCAAAATTAATCAAAAACCAAAATAA
CCAAGAATATTTTTTTACTTATTTTATTATTAATTATCAAATAAATACCTTTAATTAGCA
TTAGCAATAAATATAAAACAGTAGTAGAAAAAAGAAATGGGAAAAAAAGTAGAACAAAGC
AACACAACCGTTGAAGTTTAAGAAAACAACGACCCTTCATTAAAACGCTCAGTATTCGTT
TCAGGATTACCTTATTCAGCTGATACTGATGCTATCAAAGAATATTTCTAAAATTGTGGA
ACTATTGAAAATATCAAGCTTCCTAGATACTAAGATACAGGAAAGATTATAGGATATTGC
CATCTTGTTTTTTCAACTCCAGAAGAAGCTTAAGAGGCAATCAAATTAAATAAGCAAGTC
ATGAATGGTAGATACTTAGATATTTCACTTGCTAAGGGTGAAAAAAAAGTAGAGTACAAG
AATGATGTTAAGGCCCCTGAAGACTGCACAACAATATTCGTTAAAAACCTTGCATTCGAT
TGTACCGAAGATGAAGTTGGTGAGTTCTTTGAAAAATGCGGAAAAGTAGTTAATGTTAGA
TTCGTTTATCACTACTCTCAAAAGCACTTTAAAGGATTTGCTTTTATTGAATTTAAGATG
AACAGTTCAGTAAATGCTGCTCTTAAGTTAAATGGTACTGAATTCAAGGGTAGAAAACTC
ACAATTGATTATGAAGTTGGTTCTTAGAAGAAGGGTTTCCGTTTTAAATAGACTTAAGAT
GGCAATTAAAAATACAATAAATAGTACGAAGAGATTGTTGAATAAAAAGAAAAAAAATAG
AAGAAAATTCAAAAATTCGATAAACTTAAAAACTTTAATAACAAAAAGAAAGATTTCCCT
TAAAAAGGTAAAAAGGAAAATCTTAAGCTTTTCAAGAAATGA


>TTHERM_00047170(protein)
MNEAKQLVNKVSKINQKPKQPRIFFYLFYYQLSNKYLQLALAINIKQQQKKEMGKKVEQS
NTTVEVQENNDPSLKRSVFVSGLPYSADTDAIKEYFQNCGTIENIKLPRYQDTGKIIGYC
HLVFSTPEEAQEAIKLNKQVMNGRYLDISLAKGEKKVEYKNDVKAPEDCTTIFVKNLAFD
CTEDEVGEFFEKCGKVVNVRFVYHYSQKHFKGFAFIEFKMNSSVNAALKLNGTEFKGRKL
TIDYEVGSQKKGFRFKQTQDGNQKYNKQYEEIVEQKEKKQKKIQKFDKLKNFNNKKKDFP
QKGKKENLKLFKK


>TTHERM_00047170(gene)
AGAATATAAAGCTATTTATGAATGAAGCAAAACAATTAGTAAACAAAGTATCCAAAATTA
ATCAAAAACCAAAATAACCAAGAATATTTTTTTACTTATTTTATTATTAATTATCAAATA
AATACCTTTAATTAGCATTAGCAATAAATATAAAACAGTAGTAGAAAAAAGAAATGGGAA
AAAAAGTAGAACAAAGCAACACAACCGTTGAAGTTTAAGAAAACAACGACCCTTCATTAA
AACGCTCAGTATTCGTTTCAGGATTACCTTATTCAGCTGATACTGATGCTATCAAAGAAT
ATTTCTAAAATTGTGGAACTATTGAGTAAATAATTCTTTCTAATTCTTTAATAATTACAA
ATTACCTGCAAATGAAATTTTTATCTTTTAATCTTTATTTTATTTTTTATAGAAATATCA
AGCTTCCTAGATACTAAGATACAGGAAAGATTATAGGATATTGCCATCTTGTTTTTTCAA
CTCCAGAAGAAGCTTAAGAGGTATTTAATTTCTTTGAATCTTCATAGTCTAATATATTAA
AGAGCTTTAAAATATTCATAAAAAGGCAATCAAATTAAATAAGCAAGTCATGAATGGTAG
ATACTTAGATATTTCACTTGCTAAGGGTGAAAAAAAAGTAGAGTACAAGAGTAATAAATT
TATTTAATAAGATGAATTTAAAAAATCAAGCTTTTTATTCTTGAATTAAATTCTTAAGTG
AGAGTTAGTAAGTTAAATTAAGCCACTTTTTGTAAAATTAAAAGATGATGTTAAGGCCCC
TGAAGACTGCACAACAATATTCGTTAAAAACCTTGCATTCGATTGTACCGAAGATGAAGT
TGGTGAGTTCTTTGAAAAATGCGGAAAAGTAGTTAATGTTAGATTCGTTTATCACTACTC
TCAAAAGCACTTTAAAGGGTAAATTAATTTATTAAAATTATCTGATTACTACTGATCAAA
CAAAATAAGCTAAAGGCTTAAAGTTCTAAATAGTTAGTTAATAATTCTTCCTTAAAAATT
AGATTTGCTTTTATTGAATTTAAGATGAACAGTTCAGTAAATGCTGCTCTTAAGTTAAAT
GGTACTGAATTCAAGGGTAGAAAACTCACAATTGTAATAAATTTATTAAGCATTCATACA
TATTTTATCATTCTTAATTATTTTATTTATTTATTTATGAAGGATTATGAAGTTGGTTCT
TAGAAGAAGGGTTTCCGTTTTAAATAGACTTAAGATGGCAATTAAAAATACAATAAATAG
TAAATTAAATAATTCATTAATTAGCATAAATAATAAATAATACTTTTAAAATAAATTAAG
GTACGAAGAGATTGTTGAATAAAAAGAAAAAAAATAGAAGAAAATTCAAAAATTCGATAA
ACTTAAAAACTTTAATAACAAAAAGAAAGATTTCCCTTAAAAAGGTAAAAAGGAAAATCT
TAAGCTTTTCAAGAAATGAAAATAAAACATTAATTTATTAATTTCTATGTTATCCAGTTT
ATATTCTATACACAACTATGCATACATGGATTCAATTTTAAATTATCTCTGGCTTTCAAG
CAAAA