Identifiers and Description

Gene Model Identifier

TTHERM_00047170

Standard Name

RRM61 (RNA recognition motif-containing protein 61)

Aliases

PreTt11196 | 3.m01877 | 3824.m02955

Description

RRM61 RNA recognition motif protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 14%

TetraMine Data

TTHERM_00047170

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_01741.12.0004037638327014e-151hypothetical protein (295 aa)
OxytrichaContig17921.0.g782.99915080840225e-45RNA recognition motif_ (a_k_a_
RRM, RBD, or RNP domain)
DictyBaseDDB_G02754599.995317835403734e-19DDB_G0275459 on chromosome: 2
position 6113524 to 6114624
WormBaseWBGene000086880.00000000000003999587784428659status:Confirmed UniProt:Q95
QL3 protein_id:CAC70081.1
SGDYGR159C0.00000000000003999587784428659NSR1 Nucleolar protein that bi
nds nuclear localization seque
nces, required for pre-rRNA pr
ocessing and ribosome biogenes
is

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00047170(coding)
ATGAATGAAGCAAAACAATTAGTAAACAAAGTATCCAAAATTAATCAAAAACCAAAATAA
CCAAGAATATTTTTTTACTTATTTTATTATTAATTATCAAATAAATACCTTTAATTAGCA
TTAGCAATAAATATAAAACAGTAGTAGAAAAAAGAAATGGGAAAAAAAGTAGAACAAAGC
AACACAACCGTTGAAGTTTAAGAAAACAACGACCCTTCATTAAAACGCTCAGTATTCGTT
TCAGGATTACCTTATTCAGCTGATACTGATGCTATCAAAGAATATTTCTAAAATTGTGGA
ACTATTGAAAATATCAAGCTTCCTAGATACTAAGATACAGGAAAGATTATAGGATATTGC
CATCTTGTTTTTTCAACTCCAGAAGAAGCTTAAGAGGCAATCAAATTAAATAAGCAAGTC
ATGAATGGTAGATACTTAGATATTTCACTTGCTAAGGGTGAAAAAAAAGTAGAGTACAAG
AATGATGTTAAGGCCCCTGAAGACTGCACAACAATATTCGTTAAAAACCTTGCATTCGAT
TGTACCGAAGATGAAGTTGGTGAGTTCTTTGAAAAATGCGGAAAAGTAGTTAATGTTAGA
TTCGTTTATCACTACTCTCAAAAGCACTTTAAAGGATTTGCTTTTATTGAATTTAAGATG
AACAGTTCAGTAAATGCTGCTCTTAAGTTAAATGGTACTGAATTCAAGGGTAGAAAACTC
ACAATTGATTATGAAGTTGGTTCTTAGAAGAAGGGTTTCCGTTTTAAATAGACTTAAGAT
GGCAATTAAAAATACAATAAATAGTACGAAGAGATTGTTGAATAAAAAGAAAAAAAATAG
AAGAAAATTCAAAAATTCGATAAACTTAAAAACTTTAATAACAAAAAGAAAGATTTCCCT
TAAAAAGGTAAAAAGGAAAATCTTAAGCTTTTCAAGAAATGA


>TTHERM_00047170(protein)
MNEAKQLVNKVSKINQKPKQPRIFFYLFYYQLSNKYLQLALAINIKQQQKKEMGKKVEQS
NTTVEVQENNDPSLKRSVFVSGLPYSADTDAIKEYFQNCGTIENIKLPRYQDTGKIIGYC
HLVFSTPEEAQEAIKLNKQVMNGRYLDISLAKGEKKVEYKNDVKAPEDCTTIFVKNLAFD
CTEDEVGEFFEKCGKVVNVRFVYHYSQKHFKGFAFIEFKMNSSVNAALKLNGTEFKGRKL
TIDYEVGSQKKGFRFKQTQDGNQKYNKQYEEIVEQKEKKQKKIQKFDKLKNFNNKKKDFP
QKGKKENLKLFKK


>TTHERM_00047170(gene)
ATGAATGAAGCAAAACAATTAGTAAACAAAGTATCCAAAATTAATCAAAAACCAAAATAA
CCAAGAATATTTTTTTACTTATTTTATTATTAATTATCAAATAAATACCTTTAATTAGCA
TTAGCAATAAATATAAAACAGTAGTAGAAAAAAGAAATGGGAAAAAAAGTAGAACAAAGC
AACACAACCGTTGAAGTTTAAGAAAACAACGACCCTTCATTAAAACGCTCAGTATTCGTT
TCAGGATTACCTTATTCAGCTGATACTGATGCTATCAAAGAATATTTCTAAAATTGTGGA
ACTATTGAGTAAATAATTCTTTCTAATTCTTTAATAATTACAAATTACCTGCAAATGAAA
TTTTTATCTTTTAATCTTTATTTTATTTTTTATAGAAATATCAAGCTTCCTAGATACTAA
GATACAGGAAAGATTATAGGATATTGCCATCTTGTTTTTTCAACTCCAGAAGAAGCTTAA
GAGGTATTTAATTTCTTTGAATCTTCATAGTCTAATATATTAAAGAGCTTTAAAATATTC
ATAAAAAGGCAATCAAATTAAATAAGCAAGTCATGAATGGTAGATACTTAGATATTTCAC
TTGCTAAGGGTGAAAAAAAAGTAGAGTACAAGAGTAATAAATTTATTTAATAAGATGAAT
TTAAAAAATCAAGCTTTTTATTCTTGAATTAAATTCTTAAGTGAGAGTTAGTAAGTTAAA
TTAAGCCACTTTTTGTAAAATTAAAAGATGATGTTAAGGCCCCTGAAGACTGCACAACAA
TATTCGTTAAAAACCTTGCATTCGATTGTACCGAAGATGAAGTTGGTGAGTTCTTTGAAA
AATGCGGAAAAGTAGTTAATGTTAGATTCGTTTATCACTACTCTCAAAAGCACTTTAAAG
GGTAAATTAATTTATTAAAATTATCTGATTACTACTGATCAAACAAAATAAGCTAAAGGC
TTAAAGTTCTAAATAGTTAGTTAATAATTCTTCCTTAAAAATTAGATTTGCTTTTATTGA
ATTTAAGATGAACAGTTCAGTAAATGCTGCTCTTAAGTTAAATGGTACTGAATTCAAGGG
TAGAAAACTCACAATTGTAATAAATTTATTAAGCATTCATACATATTTTATCATTCTTAA
TTATTTTATTTATTTATTTATGAAGGATTATGAAGTTGGTTCTTAGAAGAAGGGTTTCCG
TTTTAAATAGACTTAAGATGGCAATTAAAAATACAATAAATAGTAAATTAAATAATTCAT
TAATTAGCATAAATAATAAATAATACTTTTAAAATAAATTAAGGTACGAAGAGATTGTTG
AATAAAAAGAAAAAAAATAGAAGAAAATTCAAAAATTCGATAAACTTAAAAACTTTAATA
ACAAAAAGAAAGATTTCCCTTAAAAAGGTAAAAAGGAAAATCTTAAGCTTTTCAAGAAAT
GAAAATAAAACATTAATTTATTAATTTCTATGTTATCCAGTTTATATTCTATACACAACT
ATGCATACATGGATTCAATTTTAAATTATCTCTGGCTTTCAAGCAAAATTCATTTTTTAT
TAAAATCTAAAACTAAAATTAATAATTTTTTTCAAATTGCAAAAACAATTTTGAGCTTCA
AATCAACTCTTTAATAATTAAAATTACTTTTTGTAAACATATTTTTCAAAAATTTTTTTT
ACTTACAATTAATAATTATGAAATAGCCTTCATAAAATAAATTTAATATTTATTTATTAA
AATAAATAAACTTTTTTAATTATGATAATTTTTTAATTAATTTAAAGACATAAGTTAGTT
AGTATAAAAAAGTATTTAAATTAATAATTCCTCTAAATTATCCAATTTTAATTTATTTTA
CATAAATTTTTTAATTTTTAAGAACTCTAAATAATATGCTTAAATTTAATTTGTAATTCT
CTTAAGAGTATTTTCGGGAATTATGTTTTTCATATAAGCTCAACAAAAATAAAGTTAATT
TTTAAAAAACATAAATTATTAATAAGCCAAAAAGAAATATAACAATTTATTTGTTCTATT
TGA