Identifiers and Description

Gene Model Identifier

TTHERM_00094120

Standard Name

RRM60 (RNA recognition motif-containing protein 60)

Aliases

PreTt16567 | 6.m00641 | 3836.m02224

Description

RNA recognition motif-containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF07769 ) psiF repeat
  • ( PF03880 ) DbpA RNA binding domain
  • ( TIGR01643 ) YD repeat (two copies)
  • ( PF00027 ) cyclic nucleotide-binding domain
  • ( TIGR01661 ) ELAV/HuD family splicing factor
  • ( TIGR01622 ) splicing factor, CC1-like family
  • ( TIGR01648 ) hnRNP-R, Q splicing factor family
  • ( TIGR01659 ) sex-lethal family splicing factor
  • ( PF07560 ) Domain of Unknown Function (DUF1539)
  • ( TIGR01649 ) hnRNP-L/PTB/hephaestus splicing factor family
  • ( PF00076 ) RNA recognition motif. (a.k.a. RRM,
  • ( TIGR01642 ) U2 snRNP auxilliary factor, large
  • ( TIGR01628 ) polyadenylate binding protein, human types

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.4%

TetraMine Data

TTHERM_00094120

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_02573.19.997093137033517e-262hypothetical protein (934 aa)
OxytrichaContig6706.0.g192.0004286606204839e-16Cyclic nucleotide-binding doma
in
Stentor CoeruleusSteCoe_30200.00000000003775134544279098
SGDYIL033C0.00003998524687536623BCY1 Regulatory subunit of the
cyclic AMP-dependent protein
kinase (PKA), a component of a
signaling pathway that contro
ls a variety of cellular proce
sses, including metabolism, ce
ll cycle, stress response, sta
tionary phase, and sporulation

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00094120(coding)
ATGACAGAATTGAGATAATAAACAAGCTTCGAGATGGAGAACTTAGAAGCTTAGTTTAAT
TTAGTAGATTAGGTAGATGACATCAAAGAAATAGAGCAAAATAATAATAAATTGATTAAG
AGTCTAAATAGATTCAAAAGGTAGTCTTGTATCTTCGTTGATTCAAATCAAAAAGATATC
AACTAAAAGTACAATTAACTCCTTAACAAAGAATATGTTGATTTAACAAATGAATTAGAT
AGTTCAGCTGTTATCCATATTTTGATGAAATAAGAAAAGAATAAATAAGAGCAGAACTTC
ATTAAAAATGCAATTTAAGGACTTTAGTTATTTAAAGAGCATAAAAATTTATTAACAGCT
CAAGGATTTGGAAATCACTTGCTAACATAAATGAAAGTGGAGTTTCACGAAAAAAATAAT
GTTATCTTTCACTATGGTGAATACGGTAATAAATACTACATTTTACTCAAAGGAAAGCTT
GATCTTATGATGCCAAAAAGTGAATGCATTGAAGAAAATAACTTAAGAATGGAAAAAGGC
TTACCTTCAATTCCTTATTTCTAAGAATACAAAAACACACCTGAAGAATTACCAGATGAA
ACATTTGAATAATACATGGAGAGAATATATCCTAGATTAGGACATATTAAAACATTTCTA
CCTGGTGAAGCATTTGGTGAAATTGCATTAATGACAAACCAGCAAAGAACTGGATCTATT
ATAGCAAGGGAAGATTCTTACACTTTGGTTATAACTAAGTCAGCCTTTCATGAACTTTTA
GGAAAATTTCACGAATTCATGCAAATGCAGAAATTAATTTTTTTGCAATAATTCTTTTTC
TTAAAGTAGATTCCTAGTTCAAAATTGCTATCTATTATTTAGCTCATGAAAATCTTTACA
TTCCAGAGAAACAATGTTATATATAATTAAAATTAAAGTATTAGTGGAATTTACTTTATT
AAAGAAGGAGAAGTATAAATATCCACAAAAATAACTTAAATTGATGAAGAAAACTAAGAT
GAAAGTTAAAAACTCAAAATAAGATTTAGAAACATCAAAAAATCAGAAAAAGTCATTATT
AAAGCCACAAATTCTTTCTTCGGAGAAGAAGAAATTATTTTAGGATAACATAGTAGAAAC
TCAAAAGCTATTTGTATTAGTGAAACTTGCTAAGTATTCCTTCTTTCAAGAGATATCTTG
CAAACTTATGGAAAATTATATGATATTGTTAAGAAGCTTAAATAAAATTATGATTTAAAA
TTAAAATGGGAGGAATAACGCACTTAAAATATACAAAATGTGCAAAAATAGAATGAGGAG
AATATTAATACTCTTAATTAGAACAAAGTCAAAGAGATAAATTTATCAAAATACATTTTA
GAAAGTAGTCTACCTAAAGGCAGAGTAAATTAAAGTGGCATTCCTATATACACAAATGGC
AGTGATGATTAATTAGAAAATAATGCATCTTCTTAGATGGAAGGATAAGGTATGTCAATG
AGTTCCAAAAAGTATAGAAAATTATCTTACAATATGGAAATATAAACCATGTCTAGTCCT
AAGAATTAAAATAAACTTGAATTAAACAATAATTTCCTTTAGGTTCAAAATTAAGAGAGA
GATAATAATTTTCATATTTAAAATGGTTTTTCTAGTTAAAGTTCAAGTTTGAAACGCCAG
TAGCCATACTTAAGTCCTTAACCTTCTTAAATGAAAACTTAAAATTAAACAATGACCCCA
GAAACTAACTACACAGGCCGTAAGAGTTTTCAGAGTAATATTTTTAAAAAACAAGGGAGC
AAGGAAGATATCTTAGAATCCTACAATGGATTTGGCGATAATATAAAAGAAAAAAATAAA
TTATAAAAATCTCCATCTTTTAATTATCAATTCAAGTAAAGAAATCCCAACTAAGATATT
TAACTCAATCTACAAACAAACAATTAATAAAATTCAAATACAAGTTCATAATTATCTATT
CAAAGCTTTCAAAATACTTATGCCTTTGGTAATCCTTCGTCAAACAATAAAATTTAATCC
AGTACTAACAACAGTAGAGAAACTTCAGCTGAAAGATTATTTTTTGATTCGAGCCATAAT
GAATTTGAGTCAATGCTCAAAAAATAAACTTAACTTAAGCAAGAAATTTTAAAATAAATC
AGTAAATCTAAAAATCCAACTCTTGATGGACTCACAGAAATAAATAAATAAAGAATAGAT
TTTAAAATACGCAAATAGAACAATTAATTTTTGCCAACAACACCCAAAACAATGAGAAAC
TCGTAATCATAAAGTCTTAACTACATTTAAAGTTCAAGCAAAATTTCTTAAGCTAAAAGC
TAAACTTTCATTCCTTTAGATGCTCAAGGAATGAATGATAACATATTTAGTTTAAATTCA
GAAAGCAAAAATAGCATAAATAGTAACAATGGAGTTTAGTAATATGCCAGCTTTTCTTAT
TTTCCTCCAAATGGTAGCAATACTAACATTACTGATAGAGTTGTAGTGGTACCTGCTTCA
ATGGCTAATTAAAAAATGCAATTGAATTTTTTCTCAACTAAAGTCTAAGGAAATGATTAG
CTTTAACTACCTTCTTTATCTCAATAATAATAATAATAATTATAACAGTAATAAACTTTA
GAGAAACCAATTTAGCTGCATAATCAACCCTCAATTTAAATAAATAACAACTAACCCACT
TTATATTAATTGGACACTCTTTTAGAAGAAGATGATGAAAATAGTCCTCTTAAATTTGGT
AAAAAACTTAGAATATAAATGGCAAGCTAGTAAAATATGACAGAAAATGGGTCTCATCCA
GCTTCTTAGTTAAATTTCAATTACAATTAAAATGAAAAAGATTTAGAATTATAAAAAAAT
GCTTAGATTTTATGTAAAAAATTTTAACTTGGTAAAAAAGTGGTAAAATATATCTAAAAC
AGAAAGTTCTACAATGAAAAGTTAGTTATTGACTTAGAAAAATAAATGAAGATACCTTCA
AATTCCAATACATTTAATTAATTTGATGAATTTATAAACCAGAAAAACTCTTCTTAGGTA
TCACCGTTGAATAATCTGGTAGATCAAAACCCATAGAAAGAAGTTATCATACAGGTTAAA
GTACATAAGAGGGGTGGTAGTATAATTTAACCTCCTACTTAATAAATTTAACACCACAAT
GTATAGTAGCCCATCCAATCTAATGCATAAAATCAGCTTTTGTAATAAGATGAAAAGCAA
AGTCATAGAAGAAGATTTACATATGATGCAAATTTCCATAGAGTATAGGTTAAAAAAGAT
TAGCTCAATTAACAATAATAAAACCAAAATAATAGTTGA


>TTHERM_00094120(protein)
MTELRQQTSFEMENLEAQFNLVDQVDDIKEIEQNNNKLIKSLNRFKRQSCIFVDSNQKDI
NQKYNQLLNKEYVDLTNELDSSAVIHILMKQEKNKQEQNFIKNAIQGLQLFKEHKNLLTA
QGFGNHLLTQMKVEFHEKNNVIFHYGEYGNKYYILLKGKLDLMMPKSECIEENNLRMEKG
LPSIPYFQEYKNTPEELPDETFEQYMERIYPRLGHIKTFLPGEAFGEIALMTNQQRTGSI
IAREDSYTLVITKSAFHELLGKFHEFMQMQKLIFLQQFFFLKQIPSSKLLSIIQLMKIFT
FQRNNVIYNQNQSISGIYFIKEGEVQISTKITQIDEENQDESQKLKIRFRNIKKSEKVII
KATNSFFGEEEIILGQHSRNSKAICISETCQVFLLSRDILQTYGKLYDIVKKLKQNYDLK
LKWEEQRTQNIQNVQKQNEENINTLNQNKVKEINLSKYILESSLPKGRVNQSGIPIYTNG
SDDQLENNASSQMEGQGMSMSSKKYRKLSYNMEIQTMSSPKNQNKLELNNNFLQVQNQER
DNNFHIQNGFSSQSSSLKRQQPYLSPQPSQMKTQNQTMTPETNYTGRKSFQSNIFKKQGS
KEDILESYNGFGDNIKEKNKLQKSPSFNYQFKQRNPNQDIQLNLQTNNQQNSNTSSQLSI
QSFQNTYAFGNPSSNNKIQSSTNNSRETSAERLFFDSSHNEFESMLKKQTQLKQEILKQI
SKSKNPTLDGLTEINKQRIDFKIRKQNNQFLPTTPKTMRNSQSQSLNYIQSSSKISQAKS
QTFIPLDAQGMNDNIFSLNSESKNSINSNNGVQQYASFSYFPPNGSNTNITDRVVVVPAS
MANQKMQLNFFSTKVQGNDQLQLPSLSQQQQQQLQQQQTLEKPIQLHNQPSIQINNNQPT
LYQLDTLLEEDDENSPLKFGKKLRIQMASQQNMTENGSHPASQLNFNYNQNEKDLELQKN
AQILCKKFQLGKKVVKYIQNRKFYNEKLVIDLEKQMKIPSNSNTFNQFDEFINQKNSSQV
SPLNNLVDQNPQKEVIIQVKVHKRGGSIIQPPTQQIQHHNVQQPIQSNAQNQLLQQDEKQ
SHRRRFTYDANFHRVQVKKDQLNQQQQNQNNS


>TTHERM_00094120(gene)
ATGACAGAATTGAGATAATAAACAAGCTTCGAGATGGAGAACTTAGAAGCTTAGTTTAAT
TTAGTAGATTAGGTAGATGACATCAAAGAAATAGAGCAAAATAATAATAAATTGATTAAG
AGTCTAAATAGATTCAAAAGGTAGTCTTGTATCTTCGTTGATTCAAATCAAAAAGATATC
AACTAAAAGTACAATTAACTCCTTAACAAAGAATATGTTGATTTAACAAATGAATTAGAT
AGTTCAGTAAAGTTTTATATCTAATCAATAGCTGTTCTTTTGCTAAACATTTTTTATTAA
CATAATTAGGCTGTTATCCATATTTTGATGAAATAAGAAAAGAATAAATAAGAGCAGAAC
TTCATTAAAAATGCAATTTAAGGACTTTAGTTATTTAAAGAGCATAAAAATTTATTAACA
GCTCAAGGATTTGGAAATCACTTGCTAACATAAATGAAAGTGGAGTTTCACGAAAAAAAT
AATGTTATCTTTCACTATGGTATTAATATTAATTTTTAATTGGTTCTTTTTGTAGCAAAA
ATTGCTTTATAAAATTAATTAAATACTGAAAAATATGTTAAATGTTTCGAAAAATAAATG
AATTATCTTATACTTTTATCTTGATTAAGATATTCCAGTGTATTCATTCCAAATAAATGA
ATAAATACATAAACATTCATAAGCTTTATTAAGCGAATTTATTTTTTATGAAAGTTTAGT
AGGATTTTTCTAAATATTATTTGTTTTTATTAAAAATCAGGTGAATACGGTAATAAATAC
TACATTTTACTCAAAGGTAATTTTAAGATTATATTTAATCTCTCTATTTAATTCTTAATT
AATACTATAAATTTAAGGAAAGCTTGATCTTATGATGCCAAAAAGTGAATGCATTGAAGA
AAATAACTTAAGAATGGAAAAAGGCTTACCTTCAATTCCTTATTTCTAAGAATACAAGTA
ATATTATATTTATGTAATAACTTAGATATTTATGTTAAGTTGTTTAGAAACACACCTGAA
GAATTACCAGATGAAACATTTGAATAATACATGGAGAGAATATATCCTAGATTAGGACAT
ATTAAAACATTTCTACCTGGTGAAGCATTTGGTGAAATTGCATTAATGACAAACCAGCAA
AGGTAAAGTTTTTTCAAATTAAACTATGATTAAAATAATTTTAATATAGAACTGGATCTA
TTATAGCAAGGGAAGATTCTTACACTTTGGTTATAACTAAGTCAGCCTTTCATGAACTTT
TAGGAAAATTTCACGAATTCATGCAAATGCAGAAATTAATTTTTTTGCAATAATTCTTTT
TCTTAAAGTAGATTCCTAGTTCAAAATTGCTATCTATTATTTAGCTCATGAAAATCTTTA
CATTCCAGAGAAACAATGTTATATATAATTAAAATTAAAGTATTAGTGGAATTTACTTTA
TTAAAGAAGGAGAAGTATAAATATCCACAAAAATAACTTAAATTGATGAAGAAAACTAAG
ATGAAAGTTAAAAACTCAAAATAAGATTTAGAAACATCAAAAAATCAGAAAAAGTCATTA
TTAAAGCCACAAATTCTTTCTTCGGAGAAGAAGAAATTATTTTAGGATAACATAGTAGAA
ACTCAAAAGCTATTTGTATTAGTGAAACTTGCTAAGTATTCCTTCTTTCAAGAGATGTAT
AAATCATTATTAAATTCTAATTAAATTAATTTTACATACCATAGATTTCTATAATTATTC
CACAATTTTAATTCATTTTTTTTCGAAAATTTTTTTTTTAAAACTCAAGTAAAAAATCTT
AAAATTAACATTTTTTAATTTTAATAAATTTAAAATTTACAAAAAAATATTAAAAATAAA
AATTGTTGTTTTAATTTTATATATAAATTAAAATAATTAGATCTTGCAAACTTATGGAAA
ATTATATGATATTGTTAAGAAGCTTAAATAAAATTATGATTTAAAATTAAAATGGGAGGA
ATAACGCACTTAAAATATACAAAATGTGCAAAAATAGAATGAGGAGAATATTAATACTCT
TAATTAGAACAAAGTCAAAGAGATAAATTTATCAAAATACATTTTAGAAAGTAGTCTACC
TAAAGGCAGAGTAAATTAAAGTGGCATTCCTATATACACAAATGGCAGTGATGATTAATT
AGAAAATAATGCATCTTCTTAGATGGAAGGATAAGGTATGTCAATGAGTTCCAAAAAGTA
TAGAAAATTATCTTACAATATGGAAATATAAACCATGTCTAGTCCTAAGAATTAAAATAA
ACTTGAATTAAACAATAATTTCCTTTAGGTTCAAAATTAAGAGAGAGATAATAATTTTCA
TATTTAAAATGGTTTTTCTAGTTAAAGTTCAAGTTTGAAACGCCAGTAGCCATACTTAAG
TCCTTAACCTTCTTAAATGAAAACTTAAAATTAAACAATGACCCCAGAAACTAACTACAC
AGGCCGTAAGAGTTTTCAGAGTAATATTTTTAAAAAACAAGGGAGCAAGGAAGATATCTT
AGAATCCTACAATGGATTTGGCGATAATATAAAAGAAAAAAATAAATTATAAAAATCTCC
ATCTTTTAATTATCAATTCAAGTAAAGAAATCCCAACTAAGATATTTAACTCAATCTACA
AACAAACAATTAATAAAATTCAAATACAAGTTCATAATTATCTATTCAAAGCTTTCAAAA
TACTTATGCCTTTGGTAATCCTTCGTCAAACAATAAAATTTAATCCAGTACTAACAACAG
TAGAGAAACTTCAGCTGAAAGATTATTTTTTGATTCGAGCCATAATGAATTTGAGTCAAT
GCTCAAAAAATAAACTTAACTTAAGCAAGAAATTTTAAAATAAATCAGTAAATCTAAAAA
TCCAACTCTTGATGGACTCACAGAAATAAATAAATAAAGAATAGATTTTAAAATACGCAA
ATAGAACAATTAATTTTTGCCAACAACACCCAAAACAATGAGAAACTCGTAATCATAAAG
TCTTAACTACATTTAAAGTTCAAGCAAAATTTCTTAAGCTAAAAGCTAAACTTTCATTCC
TTTAGATGCTCAAGGAATGAATGATAACATATTTAGTTTAAATTCAGAAAGCAAAAATAG
CATAAATAGTAACAATGGAGTTTAGTAATATGCCAGCTTTTCTTATTTTCCTCCAAATGG
TAGCAATACTAACATTACTGATAGAGTTGTAGTGGTACCTGCTTCAATGGCTAATTAAAA
AATGCAATTGAATTTTTTCTCAACTAAAGTCTAAGGAAATGATTAGCTTTAACTACCTTC
TTTATCTCAATAATAATAATAATAATTATAACAGTAATAAACTTTAGAGAAACCAATTTA
GCTGCATAATCAACCCTCAATTTAAATAAATAACAACTAACCCACTTTATATTAATTGGA
CACTCTTTTAGAAGAAGATGATGAAAATAGTCCTCTTAAATTTGGTAAAAAACTTAGAAT
ATAAATGGCAAGCTAGTAAAATATGACAGAAAATGGGTCTCATCCAGCTTCTTAGTTAAA
TTTCAATTACAATTAAAATGAAAAAGATTTAGAATTATAAAAAAATGCTTAGATTTTATG
TAAAAAATTTTAACTTGGTAAAAAAGTGGTAAAATATATCTAAAACAGAAAGTTCTACAA
TGAAAAGTTAGTTATTGACTTAGAAAAATAAATGAAGATACCTTCAAATTCCAATACATT
TAATTAATTTGATGAATTTATAAACCAGAAAAACTCTTCTTAGGTATCACCGTTGAATAA
TCTGGTAGATCAAAACCCATAGAAAGAAGTTATCATACAGGTTAAAGTACATAAGAGGGG
TGGTAGTATAATTTAACCTCCTACTTAATAAATTTAACACCACAATGTATAGTAGCCCAT
CCAATCTAATGCATAAAATCAGCTTTTGTAATAAGATGAAAAGCAAAGTCATAGAAGAAG
ATTTACATATGATGCAAATTTCCATAGAGTATAGGTTAAAAAAGATTAGCTCAATTAACA
ATAATAAAACCAAAATAATAGTTGA