Identifiers and Description

Gene Model Identifier

TTHERM_00248430

Standard Name

RRM6 (RNA recognition motif-containing protein 6)

Aliases

PreTt02539 | 21.m00370

Description

RNA recognition motif-containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF00076 ) RNA recognition motif. (a.k.a. RRM,

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.5%

TetraMine Data

TTHERM_00248430

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_00458.17.001881202137212e-149hypothetical protein (289 aa)
OxytrichaContig18844.0.g1037.000028900755185e-46RNA recognition motif_ (a_k_a_
RRM, RBD, or RNP domain)
SGDYNL110C3.001003044337619e-17NOP15 Constituent of 66S pre-r
ibosomal particles, involved i
n 60S ribosomal subunit biogen
esis; localizes to both nucleo
lus and cytoplasm
WormBaseWBGene000114089.997764199084386e-16status:Confirmed UniProt:Q22
135 protein_id:CAA84724.1
DictyBaseDDB_G02945590.0000000000019997478866288316DDB_G0294559 on chromosome: 4
position 1421546 to 1422592
Stentor CoeruleusSteCoe_312280.000000000013887943864964021

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00248430(coding)
ATGGGAAAACAATTAGATAAGAAGAAGCCTGCTGTTTAGAATAAGGATAAAAAAGAAAAG
AAGACCATGAAGTAACAAAAAAAACATAAGAAGGATGAAAAATAAGTTAAGGATTCTCAA
ATTAAGATCGGTCCTACCAAGAAGATTGCAAAATTAACTAAAGAAGCTGTCATTAAGAAA
GATGGTGAAAAAAAAAGCAAAGATGAAAAGAAGCCCGTCTCCACTGAACCTCTCGTTCAA
TTAAGAGATAACGTTAAAGATTCATTAGCTTTCGTCAAGAAGAAATAGGTCGATTAAAAC
GCTTTGAAGAAGGCTGTCAAGAGATTAGAAGATAAAGCTAATAGAGTTCCTATTAAAGAT
ACTCCATAAAATTGCACAATCTACGTAGGTCACTTGCCTTATGGTTTGCTTGAAGAATAA
TTAAAGACTTATTTTGAACAATATGGTACCATCGTTAATATTAAAGTTGCTAGAAGTAGA
AAGACTGCCAGATCTAAAGGTTTTGCCTTCATTTAATTTGAACAACCAGAAGTTGCTGCT
ATTGCTGCAAAGGCTATGAATGGTCATATGGTTTTAGGTAAAGTTTTAGAAGTCCATGTC
TTGCAACAAGACTAAAAGAACCCCTTCAGCTTTAAATATGGAAAGAAATAATTCAAGTTC
ATTAACTGGAAACGTATCTTCATTAAATAAAAGAATTCAGAAAAAGATCCTGAAGAAGTT
AAAAAGGGAGTAGAAAAATTACTTAAAAACGAAGAAAAGAAAAGAGACAACTTGAAGAAG
CTTGGAATAGATTATGAATTCCCAGGATTCAAAGCAATCGTTGATGGTAAAACTGTCATT
GAAGCTGACGATTGA


>TTHERM_00248430(protein)
MGKQLDKKKPAVQNKDKKEKKTMKQQKKHKKDEKQVKDSQIKIGPTKKIAKLTKEAVIKK
DGEKKSKDEKKPVSTEPLVQLRDNVKDSLAFVKKKQVDQNALKKAVKRLEDKANRVPIKD
TPQNCTIYVGHLPYGLLEEQLKTYFEQYGTIVNIKVARSRKTARSKGFAFIQFEQPEVAA
IAAKAMNGHMVLGKVLEVHVLQQDQKNPFSFKYGKKQFKFINWKRIFIKQKNSEKDPEEV
KKGVEKLLKNEEKKRDNLKKLGIDYEFPGFKAIVDGKTVIEADD


>TTHERM_00248430(gene)
ATGGGAAAACAATTAGATAAGAAGAAGCCTGCTGTTTAGAATAAGGATAAAAAAGAAAAG
AAGACCATGAAGTAACAAAAAAAACATAAGAAGGATGAAAAATAAGTTAAGGATTCTCAA
ATTAAGATCGGTCCTACCAAGAAGATTGCAAAATTAACTAAAGAAGCTGTCATTAAGAAA
GATGGTGAAAAAAAAAGCAAAGATGAAAAGAAGCCCGTCTCCACTGAACCTCTCGTTCAA
TTAAGAGATAACGTTAAAGATTCATTAGCTTTCGTCAAGAAGAAATAGGTCGATTAAAAC
GCTTTGAAGAAGGCTGTCAAGAGATTAGAAGATAAAGCTAATAGAGTTCCTATTAAAGAT
ACTCCATAAGTAATTAAACACATTACAATCAATATATATTGATCAAGTCCAGTTAAATTT
TTAGATCAATAACAATATTTTTTCATATTTGTTTATAAAACCATTTTTTTAAATTATTAA
CAGAATTGCACAATCTACGTAGGTCACTTGCCTTATGGTTTGCTTGAAGAATAATTAAAG
ACTTATTTTGAACAATATGGTACCATCGTTAATATTAAAGTTGCTAGAAGTAGAAAGGTT
AGCATAAAATTATTTGTTTAATTTCCTATTTTTTTATTTTAAGTACAAAAAACACATAAT
AATCATAATATTTATCCACTGCCTTTCCAATAATTTAGATATTATCTATTAATAAGTAGA
AATTAGCAGCTTTATTCCAGTTTTCTACTTAAAAACATTAATGTTATCTTCGATTTCTTT
TATTGTTCTTTTTTGTAGAATTTAGCTTCAATAGCAAAAATAATAATAGCTAAATTTTGG
AATTATTTGTTTCAAAATTATTTAGAAAATTTTTAATAATTTTATTTAAAATATTTATTT
AAATATAACATAGACTGCCAGATCTAAAGGTTTTGCCTTCATTTAATTTGAACAACCAGA
AGTTGCTGCTATTGCTGCAAAGGCTATGAATGGTCATATGGTTTTAGGTAAAGTTTTAGA
AGTCCATGTCTTGCAACAAGACTAAAAGAACCCCTTCAGCTTTAAATATGGAAAGAAATA
ATTCAAGTTCATTAACTGGAAACGTATCTTCATTAAATAAAAGAATTCAGTAAATATTTT
CACAACAAGCAATTATTCAATAATTATTTTGGATTTTTTTAAACTTTTACATTTTTATTT
AACTTGTAGGAAAAAGATCCTGAAGAAGTTAAAAAGGGAGTAGAAAAATTACTTAAAAAC
GAAGAAAAGAAAAGAGACAACTTGAAGAAGCTTGGAATAGATTATGAATTCCCAGGATTC
GTAATAAAATATAAATTAAAACAAATTATTAATTTTATTTTTTATTAATAGAAAGCAATC
GTTGATGGTAAAACTGTCATTGAAGCTGACGATTGA