Identifiers and Description

Gene Model Identifier

TTHERM_00295340

Standard Name

RRM59 (RNA recognition motif-containing protein 59)

Aliases

PreTt15644 | 27.m00304 | 3692.m00107

Description

polyadenylate-binding protein 2

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF00658 ) Poly-adenylate binding protein, unique domain
  • ( PF00076 ) RNA recognition motif. (a.k.a. RRM,
  • ( TIGR01628 ) polyadenylate binding protein, human types

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 12.9%

TetraMine Data

TTHERM_00295340

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_08800.19.997093137033517e-262polyadenylate-binding protein
2 (610 aa)
OxytrichaContig21044.0.g170.0000000000000299873730555305RNA recognition motif_ (a_k_a_
RRM, RBD, or RNP domain)
WormBaseWBGene000039030.00000000000009996062864481225locus:pab-2 status:Confirmed
UniProt:Q19579 protein_id
:CAA90444.1
SGDYER165W0.00000000019994075865167896PAB1 Poly(A) binding protein,
part of the 3-end RNA-processi
ng complex, mediates interacti
ons between the 5 cap structur
e and the 3 mRNA poly(A) tail,
involved in control of poly(A
) tail length, interacts with
translation factor eIF-4G
DictyBaseDDB_G02935580.0000000010002658722841845pabpc1A on chromosome: 6 posit
ion 3041877 to 3044187

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00295340(coding)
ATGTTATAAACCGCCACTTAAAATTAGAGCACACTTTTAGTCCAATTGCTCCACGAAGGT
GTCACCAAGGAACTTATTTTCAAGGAGTTCAAGAAATTCGGTACTATCAAGTCATTGAAG
CACTTCCCTAAGAACAAAAGCGCCTTAGTTGAATTCTAATCTCCTGAAGAAGCAAAGAAT
GCTAAGCAATCCCTCAATCACAATAAGCTTTTGAACAAGGAAATTAATATTGTTAATTAC
CAAAACAAGGATGAACTTAAGCAAAAGAAAAAGTATAACTTATTCATTCACAATGTTCCT
TAAGATCTCGAAACTAACACTTTACACAATTTCATGTCTAAGTATGGTGAAATTACCTCT
CTTATGCTTAAGAAGAACGATGAAAACAAGAATTTAGGTTATGGTTACGTTTAATTCGAA
ACTGAAGAAGCCTACAATGAAATTTTGAAAGAACACGAGTTAAACGGTAAGATTTCTCTT
CCTAACTCTACCATCTCTTTCAATATCTAAAAGTTCAACGATAGCAACAAAAATAAGGCC
AACAACATCGTCATTCTTGGTTTATTCGAAAACGAAATCCCAGCTGATTAAAAGGAAGCC
AAGACCTAATCAATCAACGCCATTTTCGAGAAAATTAAGTAAGAACTCAATGTTCTTCAT
TTCAATTTCTACACTGAATACAATGAAAGCAAGAAGAACTTCTGGGTCAAGGTTGATTTC
CAATACGATGATGATAAGCAAGAAGAACACATTTATAAGACTGTTAAGGAATAAGTTTAA
AAGAATTTCTCTTACTCAGGAGCCTAAAACAAGGGACCTACCATTAACTTCAAGTCTAAT
GAAAGCAGTGAAAGAAATCTTTTCTTCTTAGGTGTCAAGATTGACATTAAGGAATAAGAC
ATTGCTGATTGGATTCAAAAGGCTATTGGTGTTTCTGTTCCTACTGAGAGCATTAAAATT
AAAAAGAGAACTAAACCCGCCAATGCTGACGATCAATTAAAAACTAACAATGTTTCAGTT
TTCTTTGATTCTTAGGCTGACGGTCAAAAGTTGATGATTTTCTGTGCTAAATAATCTAAT
AAAAACTCTGTTGATGAAATCTTCGACAACAGACACAAGGTCACTCTTTATCTCAAAAAG
AATGAACAAGAAAGTGTCTAAAAGTTGACTAAAAAAATTGGTGAATTCCAACAAAATAGC
ACTATGGGTAGCAACAAATTCTAAACTGACATTTAAGCTCCTAACCCAATTCACCCCTAT
GGATACCCTATTCCTATGTTCATGCCCCAATAAATCCCCTTCTAAAATTAATAACCAAAG
CTTATTAACATTCCTTCTATGTAACATAATAAGAAGATTTAAAACACTCCTTAACCAATT
GAACCTAAACCTCAAACTCTTATTGCTGTTCCTAATAAACCTGCTGCTCCTCAAAATATT
TTTATTTAGTTCGAAAAGGCTACTGCAGAAGAAAAGAAGAATAAAATTGAACAAATTACT
AATGCCATTTCAACTTAATTCAGCGATTTCGATAAGCTTCAAGATGAATCAAAGAGAAGT
ATTCTTGGTCAAATCATTTACTATAAAATTTCTGAACTTGATCTTGACAAGAATAGAAAA
ATCATGGAATATATCCCTGATGTTTAAAACGAAAACCAAGCTAGAGCTAAAATCGCTGAA
TTCAAACAACAAGTCCCCAAAATTACTGGTATGCTTATCGATACTGACGTCTTCGAAGTT
GCTGATATCGTCGACATCGTTAAAGACGAAAAGGAACTTATTGAAAGATGCAGTGAAGCT
ATCGATCTTATTATTAGTCAAAAGAAATGA


>TTHERM_00295340(protein)
MLQTATQNQSTLLVQLLHEGVTKELIFKEFKKFGTIKSLKHFPKNKSALVEFQSPEEAKN
AKQSLNHNKLLNKEINIVNYQNKDELKQKKKYNLFIHNVPQDLETNTLHNFMSKYGEITS
LMLKKNDENKNLGYGYVQFETEEAYNEILKEHELNGKISLPNSTISFNIQKFNDSNKNKA
NNIVILGLFENEIPADQKEAKTQSINAIFEKIKQELNVLHFNFYTEYNESKKNFWVKVDF
QYDDDKQEEHIYKTVKEQVQKNFSYSGAQNKGPTINFKSNESSERNLFFLGVKIDIKEQD
IADWIQKAIGVSVPTESIKIKKRTKPANADDQLKTNNVSVFFDSQADGQKLMIFCAKQSN
KNSVDEIFDNRHKVTLYLKKNEQESVQKLTKKIGEFQQNSTMGSNKFQTDIQAPNPIHPY
GYPIPMFMPQQIPFQNQQPKLINIPSMQHNKKIQNTPQPIEPKPQTLIAVPNKPAAPQNI
FIQFEKATAEEKKNKIEQITNAISTQFSDFDKLQDESKRSILGQIIYYKISELDLDKNRK
IMEYIPDVQNENQARAKIAEFKQQVPKITGMLIDTDVFEVADIVDIVKDEKELIERCSEA
IDLIISQKK


>TTHERM_00295340(gene)
AAAAAAAAAAAAGAGACCAAAAAACAAACAAAAGGACAAACCTTTAAAAAAAAAAAAAAA
ACAAAAAAAGACAAAAAAGAAAAAATGTTATAAACCGCCACTTAAAATTAGAGCACACTT
TTAGTCCAATTGCTCCACGAAGGTGTCACCAAGGAACTTATTTTCAAGGAGTTCAAGAAA
TTCGGTACTATCAAGTCATTGAAGCACTTCCCTAAGAACAAAAGCGCCTTAGTTGAATTC
TAATCTCCTGAAGAAGCAAAGAATGCTAAGCAATCCCTCAATCACAATAAGCTTTTGAAC
AAGGAAATTAATATTGTTAATTACCAAAACAAGGATGAACTTAAGCAAAAGAAAAAGTAT
AACTTATTCATTCACAATGTTCCTTAAGATCTCGAAACTAACACTTTACACAATTTCATG
TCTAAGTATGGTGAAATTACCTCTCTTATGCTTAAGAAGAACGATGAAAACAAGAATTTA
GGTTATGGTTACGTTTAATTCGAAACTGAAGAAGCCTACAATGAAATTTTGAAAGAACAC
GAGTTAAACGGTAAGATTTCTCTTCCTAACTCTACCATCTCTTTCAATATCTAAAAGTTC
AACGATAGCAACAAAAATAAGGCCAACAACATCGTCATTCTTGGTTTATTCGAAAACGAA
ATCCCAGCTGATTAAAAGGAAGCCAAGACCTAATCAATCAACGCCATTTTCGAGAAAATT
AAGTAAGAACTCAATGTTCTTCATTTCAATTTCTACACTGAATACAATGAAAGCAAGAAG
AACTTCTGGGTCAAGGTTGATTTCCAATACGATGATGATAAGCAAGAAGAACACATTTAT
AAGACTGTTAAGGAATAAGTTTAAAAGAATTTCTCTTACTCAGGAGCCTAAAACAAGGGA
CCTACCATTAACTTCAAGTCTAATGAAAGCAGTGAAAGAAATCTTTTCTTCTTAGGTGTC
AAGATTGACATTAAGGAATAAGACATTGCTGATTGGATTCAAAAGGCTATTGGTGTTTCT
GTTCCTACTGAGAGCATTAAAATTAAAAAGAGAACTAAACCCGCCAATGCTGACGATCAA
TTAAAAACTAACAATGTTTCAGTTTTCTTTGATTCTTAGGCTGACGGTCAAAAGTTGATG
ATTTTCTGTGCTAAATAATCTAATAAAAACTCTGTTGATGAAATCTTCGACAACAGACAC
AAGGTCACTCTTTATCTCAAAAAGAATGAACAAGAAAGTGTCTAAAAGTTGACTAAAAAA
ATTGGTGAATTCCAACAAAATAGCACTATGGGTAGCAACAAATTCTAAACTGACATTTAA
GCTCCTAACCCAATTCACCCCTATGGATACCCTATTCCTATGTTCATGCCCCAATAAATC
CCCTTCTAAAATTAATAACCAAAGCTTATTAACATTCCTTCTATGTAACATAATAAGAAG
ATTTAAAACACTCCTTAACCAATTGAACCTAAACCTCAAACTCTTATTGCTGTTCCTAAT
AAACCTGCTGCTCCTCAAAATATTTTTATTTAGTTCGAAAAGGCTACTGCAGAAGAAAAG
AAGAATAAAATTGAACAAATTACTAATGCCATTTCAACTTAATTCAGCGATTTCGATAAG
CTTCAAGATGAATCAAAGAGAAGTATTCTTGGTCAAATCATTTACTATAAAATTTCTGAA
CTTGATCTTGACAAGAATAGAAAAATCATGGAATATATCCCTGATGTTTAAAACGAAAAC
CAAGCTAGAGCTAAAATCGCTGAATTCAAACAACAAGTCCCCAAAATTACTGGTATGCTT
ATCGATACTGACGTCTTCGAAGTTGCTGATATCGTCGACATCGTTAAAGACGAAAAGGAA
CTTATTGAAAGATGCAGTGAAGCTATCGATCTTATTATTAGTCAAAAGAAATGA