Identifiers and Description

Gene Model Identifier

TTHERM_00691350

Standard Name

RRM57 (RNA recognition motif-containing protein 57)

Aliases

PreTt02973 | 106.m00113 | 3674.m00026

Description

polyadenylate-binding protein 2

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF00076 ) RNA recognition motif. (a.k.a. RRM,

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 11.2%

TetraMine Data

TTHERM_00691350

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_08800.19.997329401607134e-86polyadenylate-binding protein
2 (610 aa)
WormBaseWBGene000039020.00000000000020009182674645818locus:pab-1 status:Confirmed
UniProt:Q9U302 protein_id
:CAA21572.1
OxytrichaContig21044.0.g170.00000000000020009182674645818RNA recognition motif_ (a_k_a_
RRM, RBD, or RNP domain)
SGDYER165W0.00000000002000577768187062PAB1 Poly(A) binding protein,
part of the 3-end RNA-processi
ng complex, mediates interacti
ons between the 5 cap structur
e and the 3 mRNA poly(A) tail,
involved in control of poly(A
) tail length, interacts with
translation factor eIF-4G
DictyBaseDDB_G02907450.0000000010002658722841845pabpc1B on chromosome: 5 posit
ion 4494408 to 4497035

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00691350(coding)
ATGTAGAAAAACTCCTCATAAAATTAGAGTACTACTCTTTTTATCCAATCACTCCATTAG
GATGTTACCAAGAATTTACTTTTCAAGTAGTTCAAGAAATTTGGTACTATCGAGTCATTG
AAGCACTTCCCTAAGAACAGAACAGCCTTAGTTGAATTCTAAACTCCTGAAGAAGCACAG
AATGCTAAGTAAAGCCTCAATTACATAAAGCTTCTTGGCAAGGAAATTAATATTATTAAT
TACTAAACTAAGGATGAACTTGAGCAAAAGAAAGATTATAACTTATTAATTCAAAATGTT
CCTTTAGATCTTGAAACCATTACTTTACACAATTTTATGACTAAGTATGGTGAAATAAGC
TCTCTATTACTTAAGAAGGACTAATTAAACTAGAATTTAGGTGATGGTTTTATTCAATTC
GAAACTAAAGAAGCATGCGATAAAATTTTGAAAGAACATGAGTAAAATGGTAAGATTTCT
CTTCCTAACTCTAATATCTCTTTCAATATCTAAAAAAACAACTAAATCAAGTAAAAAAAT
ACAAAAATCATGATTTATGGTTTATTCGAGCATGAAATCGCAGCTGATTAAAAGGAATCC
AAGACTTAATCAATCAATGCCATTTTCGAAGAAATTAAGAAAGACCTTTAAGTTGATTTT
AATTTCTATACTGAATACAACGAAAAAAAGAAGAATTTCTGGGCCAAGGTTGATTTTACA
TACGATGATGATTAGCAAAAAGAAGAGATTTGTAAGATTATTATAGAATAAGTTCAAAAG
AATTTCCATTACTCAGGAGATTAAAGCAAGGGACCTAAGATTGTTAGTTGA


>TTHERM_00691350(protein)
MQKNSSQNQSTTLFIQSLHQDVTKNLLFKQFKKFGTIESLKHFPKNRTALVEFQTPEEAQ
NAKQSLNYIKLLGKEINIINYQTKDELEQKKDYNLLIQNVPLDLETITLHNFMTKYGEIS
SLLLKKDQLNQNLGDGFIQFETKEACDKILKEHEQNGKISLPNSNISFNIQKNNQIKQKN
TKIMIYGLFEHEIAADQKESKTQSINAIFEEIKKDLQVDFNFYTEYNEKKKNFWAKVDFT
YDDDQQKEEICKIIIEQVQKNFHYSGDQSKGPKIVS


>TTHERM_00691350(gene)
ATGTAGAAAAACTCCTCATAAAATTAGAGTACTACTCTTTTTATCCAATCACTCCATTAG
GATGTTACCAAGAATTTACTTTTCAAGTAGTTCAAGAAATTTGGTACTATCGAGTCATTG
AAGCACTTCCCTAAGAACAGAACAGCCTTAGTTGAATTCTAAACTCCTGAAGAAGCACAG
AATGCTAAGTAAAGCCTCAATTACATAAAGCTTCTTGGCAAGGAAATTAATATTATTAAT
TACTAAACTAAGGATGAACTTGAGCAAAAGAAAGATTATAACTTATTAATTCAAAATGTT
CCTTTAGATCTTGAAACCATTACTTTACACAATTTTATGACTAAGTATGGTGAAATAAGC
TCTCTATTACTTAAGAAGGACTAATTAAACTAGAATTTAGGTGATGGTTTTATTCAATTC
GAAACTAAAGAAGCATGCGATAAAATTTTGAAAGAACATGAGTAAAATGGTAAGATTTCT
CTTCCTAACTCTAATATCTCTTTCAATATCTAAAAAAACAACTAAATCAAGTAAAAAAAT
ACAAAAATCATGATTTATGGTTTATTCGAGCATGAAATCGCAGCTGATTAAAAGGAATCC
AAGACTTAATCAATCAATGCCATTTTCGAAGAAATTAAGAAAGACCTTTAAGTTGATTTT
AATTTCTATACTGAATACAACGAAAAAAAGAAGAATTTCTGGGCCAAGGTTGATTTTACA
TACGATGATGATTAGCAAAAAGAAGAGATTTGTAAGATTATTATAGAATAAGTTCAAAAG
AATTTCCATTACTCAGGAGATTAAAGCAAGGGACCTAAGATTGTTAGTTGA