Identifiers and Description

Gene Model Identifier

TTHERM_00101150

Standard Name

RRM56 (RNA recognition motif-containing protein 56)

Aliases

PreTt22914 | 7.m00363

Description

splicing factor, CC1-like family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( TIGR00087 ) 5'/3'-nucleotidase SurE
  • ( TIGR01661 ) ELAV/HuD family splicing factor
  • ( TIGR01622 ) splicing factor, CC1-like family
  • ( TIGR01645 ) poly-U binding splicing factor, half-pint
  • ( PF00076 ) RNA recognition motif. (a.k.a. RRM,
  • ( TIGR00449 ) tRNA-guanine transglycosylases, various specificities
  • ( TIGR01642 ) U2 snRNP auxilliary factor, large
  • ( TIGR01628 ) polyadenylate binding protein, human types

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.9%

TetraMine Data

TTHERM_00101150

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_00288.19.997093137033517e-262splicing factor, CC1-like fami
ly protein (548 aa)
OxytrichaContig10134.0.g988.99739772315193e-58RNA recognition motif_ (a_k_a_
RRM, RBD, or RNP domain)
WormBaseWBGene000219212.0008113830639685e-30status:Partially_confirmed U
niProt:Q8MXS6 protein_id:CCD
74061.1
Stentor CoeruleusSteCoe_35885.74952226429356e-19
DictyBaseDDB_G02836870.0000000000002999981760818895DDB_G0283687 on chromosome: 4
position 982205 to 984735
SGDYER165W0.0000000008996637801615584PAB1 Poly(A) binding protein,
part of the 3-end RNA-processi
ng complex, mediates interacti
ons between the 5 cap structur
e and the 3 mRNA poly(A) tail,
involved in control of poly(A
) tail length, interacts with
translation factor eIF-4G

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00101150(coding)
ATGGATATAGATCTAGACTAAGCTGAAGCTCTTTTTAACTAATAGGCAAATCAAGGATTA
GAAAACGGTTCCAACGGGGACATTAGAGATGACAAAGATGAAAAAAAGAGCAAAAAGAAG
AAGCATCATAAATCAAAAAGCAGATCAAGATCCAACAAGAAGAAAAGCAAAAAGAAACAT
AGCAGTAGATCCAGATCCAGATCTGGCAAAAAAAGCAAAAAGCATCGTTCCAGATCATCA
AAGAAGGACAAGAAGCACCATCACTCTTCTGAAAGAAAAACTGAAGAAAAATAGAGCTAA
GAGGCTATCTCGAAGTCTTAAGAAACAAGACAGCTAACATCTGTCGAAAGAATCGAGCTA
AAAAAGAGGGAGCTTGAGCAATAAATTGAAAAATTAAACAAGGATGCAGAAGATGCTGCC
AGAGAAGATTTAACTGTTATGATTTATTAGCTACCTTCAAAGGCTGAGGAAAAAGATATT
TGGCGTTACTTAACCAAACATTGTGGTGCTTCTAAAGTTAGAGATATTAAGCTCATTAGA
GATTAAAAGACTAAGAAGTCTAAGGGTGTTGCTTATGCTGAATTTTATATTAAGGAAGAT
GTTGACAAAGCTTTGGCTGCTGACACTAAACCTTTCTTCTTAAAAGGTGAAGAAGTGCCA
ATGTCTGAAGTGAGAATCCAGCATTCATAAGCCGAAAAGAACAGAGCTGCCTTAGCTGCA
AGAGAAATTAAGAGACAAAGAGCAGAAGCCTTAAAAGAGCAATTAGCCAAGTTACAAGAA
GGTCCTGTTAAAGTTTTTGTTGGTGGTTTAAATGGAAAACTAGCTGATATGAACGAATAA
GATTTAAAGGATATATTCTAAAAATACGGTGATATTGAATCTGTTGAATTGCCTGTTAAT
GCTTAAGGAAAATGCCTTGGTTTTGGTTACTTGACTTTCAAAAAGAAAAGTGATGCTCAT
GAAGCTATTAAGATGATGAATGGATTTAAATTATAAGATCAAAAGATTTCTGTTACTCCT
GTAGCAGTTAATTTATCTTTCGCTCCCGTTCAACCTCTTTTCCCTTCAAGTTTAGGAGGA
ACTCAAACTCAAGATAACATTGATTTAGATCAGAATGAAAATAAAGTTTTCTTGCACTCA
GCAGCCAAAAAGCTGGAATTAATGAAGAAATTAGCAGGTAACTCTACTCTTTCTGTGCCT
GGAACTGAAACAGCTGCTTAGCCTACTGTAAACACTCCACTTCCTATTCCTGGTATAGCC
AATTTACCAAGCTTGAATATAGCTCAGAATCCTTAAATTCAAAATAACTTCATGGCTGGA
AATAGACCTCCTACAAGTTTGTTGCCCACCAACTATATAGTATTAGTAAATATGTTTGCA
GAAAGTGATTTCAAAAATGATCCCTCTTTCTTTGCAGATCTTAAAGAAGATGTTAGTGAG
GAATGCAAAAAGTATGGTGATGTTGTTGAAGTATTTGTAGCAATTCGTAGTCCTTGTGGT
TCTGTATTTGTATTGTTTAATGATGCTGTTGGTGCAGTTACTTGTGCAAAGAATATGGAT
GGAAGAATGTTTAATGGAAGACCTATTTCTTCTTATTGTATTTCAGAAGATACTCTACAA
GATGAATTACAAGAACATCTCTGA


>TTHERM_00101150(protein)
MDIDLDQAEALFNQQANQGLENGSNGDIRDDKDEKKSKKKKHHKSKSRSRSNKKKSKKKH
SSRSRSRSGKKSKKHRSRSSKKDKKHHHSSERKTEEKQSQEAISKSQETRQLTSVERIEL
KKRELEQQIEKLNKDAEDAAREDLTVMIYQLPSKAEEKDIWRYLTKHCGASKVRDIKLIR
DQKTKKSKGVAYAEFYIKEDVDKALAADTKPFFLKGEEVPMSEVRIQHSQAEKNRAALAA
REIKRQRAEALKEQLAKLQEGPVKVFVGGLNGKLADMNEQDLKDIFQKYGDIESVELPVN
AQGKCLGFGYLTFKKKSDAHEAIKMMNGFKLQDQKISVTPVAVNLSFAPVQPLFPSSLGG
TQTQDNIDLDQNENKVFLHSAAKKLELMKKLAGNSTLSVPGTETAAQPTVNTPLPIPGIA
NLPSLNIAQNPQIQNNFMAGNRPPTSLLPTNYIVLVNMFAESDFKNDPSFFADLKEDVSE
ECKKYGDVVEVFVAIRSPCGSVFVLFNDAVGAVTCAKNMDGRMFNGRPISSYCISEDTLQ
DELQEHL


>TTHERM_00101150(gene)
ATGGATATAGATCTAGACTAAGCTGAAGCTCTTTTTAACGTAATTAAATTTACCTTTTAA
ATCTCTTAAAAATAACATAGCGCTATAAAATTTACTTTGATAAATAGTTAATATTTCACT
AATTCCCATTTATTTTGTTACCATTTTTAACTTAAATCATCAATTAGGTGGCTATTTACA
CTAAAAACAAACAAAGTATGCCAAAAATAATAAAAATTTTTTAGGTCTTTAATATAAAAC
AATAAAAGCATTTGCTCTTTAAATTTAGGTGCACATAAATAATTAAAAAAAAGATAACTC
ACCTGAAAATTCGTTTAAAAATGCCAATAGCTTCATCTTTTGAGAAAGATAATTTTTGCT
AGACATTTTTTTCAATTTCAGAATCAAAATTAGATTTAAAATTTGAAAAATCAGCGAGGA
AAATGCAATTAATAAATAAAAAAAACTTATTTAATATTCAAACAAATTAATAATTTATAA
TATCTGAAACTTTTATATGTAAAATAAAAGAATAATTTTCTAAATGTCTTAAGGAAAAGC
AATTTTTTGTTTAACCATTTAATTATAATAATTTTTCCCATAAAATTTTTAAAAAAATAT
GTGAATAGCCCTCTAGTTTTAAGAAATAATTTAGAGATATTAAATATTTTGTAATGCGTT
ATTTTGTTTGTGGAAATAATACATAATTTTTCTGAATATCTTCCTTTTTACCATGATTCA
GGCTCTAGAGAAAAATTATCCGAAAATGAGTTGCCATCATTCATTACACTACTTTGCCAC
ACATTCCCACATAATTGTCACTGCCAACAACAACTGACACTACTTAAATCTCACTTTAGT
TTGGAATAAATTAGAAGAACAATAAAAAATAAATAAAATAGGTAGTTAGTTAGTGAGTAA
ATAGAGATTAAAGGAGAAGATTCAAACAAACTAAACTAAATCGTTTTGTTAGTTAGTTGT
GGTGCGGGAAGTTGTTGTTGACCTTCCTTTTTAAATAAATTATAAAAAAATATAATTTAG
GGAAATTTTGAAGTTTTTTGTTTGCCTCAACTTGAAACTTAAGATAATAAATAAAATAAT
TTTAGGGCTAAAAATTTAAAAACAGATTTTTATAGGATTTTGGAGAATTTTTAGATTATT
AGTTAAATGTTGAATAAGCTTCAGCATTTAATTAATGACAGTGACATTAAAATAAAAAAA
TATAATAGAGTTAATTATTATAGCAGCATATTAATAAATAAATAAAGCATTCATATGAAC
AAGAATTTAGAATATAAAAATGATTCTAACTATCTATCTATCTCTTCTCTCTTATAAAAT
AAATAAAAAAGTAATAGGCAAATCAAGGATTAGAAAACGGTTCCAACGGGGACATTAGAG
ATGACAAAGATGAAAAAAAGAGCAAAAAGAAGAAGCATCATAAATCAAAAAGCAGATCAA
GATCCAACAAGAAGAAAAGCAAAAAGAAACATAGCAGTAGATCCAGATCCAGATCTGGCA
AAAAAAGCAAAAAGCATCGTTCCAGATCATCAAAGAAGGACAAGAAGCACCATCACTCTT
CTGAAAGAAAAACTGAAGAAAAATAGAGCTAAGAGGCTATCTCGAAGTCTTAAGAAACAA
GACAGCTAACATCTGTCGAAAGAATCGAGCTAAAAAAGAGGGAGCTTGAGCAATAAATTG
AAAAATTAAGTAAATTTTATTTATTAAATTACTCTAAAAATAATTCAAGCTAATATCAAT
AATCAAAATATCACTAATATATAATTTTTTTTATCATTAGACAAGGATGCAGAAGATGCT
GCCAGAGAAGATTTAACTGTTATGATTTATTAGCTACCTTCAAAGGCTGAGGAAAAAGAT
ATTTGGCGTTACTTAACCAAACATTGTGGTGCTTCTAAAGTTAGAGATATTAAGCTCATT
AGAGATTAAAAGACTAAGAAGTCTAAGGGTGTTGCTTATGCTGAATTTTATATTAAGGAA
GATGTTGACAAAGCTTTGGCTGCTGACACTAAACCTTTCTTCTTAAAAGGTGAAGAAGTG
CCAATGTCTGAAGTGAGAATCCAGCATTCATAAGCCGAAAAGAACAGAGCTGCCTTAGCT
GCAAGGTATTTAATTAAAATACTTTTTATCATTTATTTTTTTAAAATACTAATTCATATC
TTGTTTCTATTCATTGTTGAAATTAAAGTTATATTTTTTTTAAAATCAATAATTGTTAAA
TGAAAAGAGAAATTAAGAGACAAAGAGCAGAAGCCTTAAAAGAGCAATTAGCCAAGTTAC
AAGAAGGTCCTGTTAAAGTTTTTGTTGGTGGTTTAAATGGAAAACTAGCTGATATGAACG
AATAAGATTTAAAGGATATATTCTAAAAATACGGTGATATTGAATCTGTTGAATTGCCTG
TTAATGCTTAAGGAAAATGCCTTGGTTTTGGTTACTTGACTTTCAAAAAGAAAAGTGATG
CTCATGAAGCTATTAAGATGATGAATGGATTTAAATTATAAGATCAAAAGATTTCTGTTA
CTCCTGTAGCAGTTAATTTATCTTTCGCTCCCGTTCAACCTCTTTTCCCTTCAAGTTTAG
GAGGAACTCAAACTCAAGATAACATTGATTTAGATCAGAATGAAAGTAAGCAAATTATTA
GATAAAAAATATAAAAGATTTTTGTGATAAAAAATAAATAGACGCAAAACATACTTTAAA
TTTTATATTTATTTATTTATTTATTTATTTATTAATATATTAGATAAAGTTTTCTTGCAC
TCAGCAGCCAAAAAGCTGGAATTAATGAAGAAATTAGCAGGTAACTCTACTCTTTCTGTG
CCTGGAACTGAAACAGCTGCTTAGCCTACTGTAAACACTCCACTTCCTATTCCTGGTATA
GCCAATTTACCAAGCTTGAATATAGCTCAGAATCCTTAAATTCAAAATAACTTCATGGCT
GGAAATAGACCTCCTACAAGTTTGTTGCCCACCAACTATATAGTATTAGTAAATATGTTT
GCAGAAAGTGATTTCAAAAATGATCCCTCTTTCTTTGCAGATCTTAAAGAAGATGTTAGT
GGTAATTAAATGATTTAATTGATCAAAAAACTTATTCATATTAAATTAGTTAAGTTAATA
CTAAATATTTTATTATAATTATTTATTAGAGGAATGCAAAAAGTATGGTGATGTTGTTGA
AGTATTTGTAGCAATTCGTAGTCCTTGTGGTTCTGTATTTGTATTGTTTAATGATGCTGT
TGGTGCAGTTACTTGTGCAAAGAATATGGATGGAAGAATGTTTAATGGAAGACCTATTTC
TTCTTATTGTATTTCAGAAGATACTCTACAAGATGAATTACAAGAACATCTCTGA