Identifiers and Description

Gene Model Identifier

TTHERM_00194550

Standard Name

RRM55 (RNA recognition motif-containing protein 55)

Aliases

PreTt06739 | 16.m00395

Description

RNA recognition motif-containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF00076 ) RNA recognition motif. (a.k.a. RRM,

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 14.8%

TetraMine Data

TTHERM_00194550

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_03730.12.9990501533945683e-168hypothetical protein (626 aa)
OxytrichaContig15147.0.g559.997975313387782e-28RNA recognition motif_ (a_k_a_
RRM, RBD, or RNP domain)
SGDYNL197C0.000019995566179747357WHI3 RNA binding protein that
sequesters CLN3 mRNA in cytopl
asmic foci; cytoplasmic retent
ion factor for Cdc28p and asso
ciated cyclins; regulates cell
fate and dose-dependently reg
ulates the critical cell size
required for passage through S
tart

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00194550(coding)
ATGAGCTAAATGCTTATTGTTAGCAATTTGCCATATTCTACAAACTAAGAAGAAATCAAA
GAGCGGTTTAGAGATTATAAAGGATTTTTAACTTCAAGAGTTTTTTATAATGAAAAGCAT
AGCTTAGTTGCCGAATATGAATTTAATAATTATGAATCTGCAGAAATAGCTAAAAACTCA
TTTAATAGTTATTTAATCACCAATCCATCTCTAAGAATTAGTATAGAATATAAAGAACAT
TCATATCAAAATCAGTATCATGGTGAATACCATTAATATTCTAATCAATTAGTCACTTCA
AATTAACAAATAAATATGGGAATGTCTTATTTATCTTAGCCTTCTTAATAATAACAGTCG
CAGCAGCTTCCAATTTCTCATTAGAATTAACAATATTCAGCTGCTGATTACCAACATCAC
CAGTAATAATACCAAAATCCTCTCGTGAATTAATAGCATTCACAAGTCCAGTAATATTAG
CAGTACACACAAAGTTAACTTTAGAATCAGTAACAACCTCAACAACAAACTCCTCATAGT
GGTGCTATCTTATAGCAATAATAATAGCAATAACCACTTACTCCTAATCACTACCAATAA
AATTCAGTTTTCTCTAACTAGAATCACCTAGGCCATTAACACCCATCTTAGGCAGTATAG
CCATAACAGGCTTAGCCTCCTGCTCATTAACACATTTTAGATTAATAACCCCATCATTCT
GGAATTGTTATAAATAATTCTTCTATGTATAATTAACAGCAACAGCCACAACATTAAAAT
CAGCATTTAATAAATCAACAAGGATATCAATAATAGTAGTAATAACCCCAATAATAGTAA
TAACAATAGCAACCACATATTCCATAGTCATAGCCACCTCCTCCTCCATCCTAAAATATG
CTTCTGTCTCCTAATATCAATCCTATTTAGAATCCTCATCTATAACAATAGACTCCACTA
AGTGCAGCTCGTTCTATTTAAACTCCTTAATAAATATACTAACAGCCTCCTTAGCTCCCA
TAAATGTAATAACTGAATAGCAATTAGAGCAACAGTGGTATTCTTTACTAATAAAATTAC
AACTAATAATCGCATCACATTCAGGTTCCACAAACTTAACCTCCACCACCTCCTTAAACT
CAGTAGCATACTTAATATACGAATCAATCTTTCAGCAGCATGAATAATAACTATGTAGCA
AACTAGTTAATTAATGTTTTAAACTAAGTAAATTAGTTAGAACTCAATACTTGCAATAAA
GTTGTAGAAGCAACAAATTCACTATATGTGGATGGAGTACCTATAGATTCAAACGAAAGG
GAAGTTTCACACATTTTTAGGCCTTTCCCTGGATTCTAAGCTGTAAGATTAATAAGAAAG
CGCACATAAGCAGGAAGAGAATTTTATTTTTGTTTTGTCGACTTTGAAAGTGCTCTTTAA
TCAACAATAGCATTAAGAACTTTACAAGGATACAGATTTGATAAAAAAGACACACAAGGA
CTGAAAATTTCATACGCAAACGAGCCTCACTAACCAAAAAAACAAGAATAGTTTGGAGTA
AATAATAATTAACTGAATTTAAACTAGTCTTACTCTTAAACTAGTATTCAGCTCGGCAGC
ACAGAAAATAATAGTATAAATAATAGCTATCAAATGAATTAATAAAATTATAATAATTAA
AACATTCACTAAAAAGTTAATAATAATACTAATTCTTCTAATAAGCAAAAAAACAACTTC
AACAAACAAAGATAAAAAAAGTGA


>TTHERM_00194550(protein)
MSQMLIVSNLPYSTNQEEIKERFRDYKGFLTSRVFYNEKHSLVAEYEFNNYESAEIAKNS
FNSYLITNPSLRISIEYKEHSYQNQYHGEYHQYSNQLVTSNQQINMGMSYLSQPSQQQQS
QQLPISHQNQQYSAADYQHHQQQYQNPLVNQQHSQVQQYQQYTQSQLQNQQQPQQQTPHS
GAILQQQQQQQPLTPNHYQQNSVFSNQNHLGHQHPSQAVQPQQAQPPAHQHILDQQPHHS
GIVINNSSMYNQQQQPQHQNQHLINQQGYQQQQQQPQQQQQQQQPHIPQSQPPPPPSQNM
LLSPNINPIQNPHLQQQTPLSAARSIQTPQQIYQQPPQLPQMQQLNSNQSNSGILYQQNY
NQQSHHIQVPQTQPPPPPQTQQHTQYTNQSFSSMNNNYVANQLINVLNQVNQLELNTCNK
VVEATNSLYVDGVPIDSNEREVSHIFRPFPGFQAVRLIRKRTQAGREFYFCFVDFESALQ
STIALRTLQGYRFDKKDTQGLKISYANEPHQPKKQEQFGVNNNQLNLNQSYSQTSIQLGS
TENNSINNSYQMNQQNYNNQNIHQKVNNNTNSSNKQKNNFNKQRQKK


>TTHERM_00194550(gene)
TTAGAATTTAGAAAAATATCTATCAATATTCATAAAATGAGCTAAATGCTTATTGTTAGC
AATTTGCCATATTCTACAAACTAAGAAGAAATCAAAGAGCGGTTTAGAGATTATAAAGGA
TTTTTAACTTCAAGAGTTTTTTATAATGAAAAGCATAGGTAAAACATTAATTTGAATGTT
TTAAAATTTATGTTTTGAGAAACATTTGAATTCATTAAAACTTAATTTTTTAAATTAAAA
TATTTGATTTATTTATTTTCTATTATAAATATATTAGCTTAGTTGCCGAATATGAATTTA
ATAATTATGAATCTGCAGAAATAGCTAAAAACTCATTTAATAGTTATTTAATCACCAATC
CATCTCTAAGAATTAGTATGAATATTTAGATAATCTAAATATTTACAAAGCTTTTAAAAT
ATAGGTATAGAATATAAAGAACATTCATATCAAAATCAGTATCATGGTGAATACCATTAA
TATTCTAATCAATTAGTCACTTCAAATTAACAAATAAATGTATTAATCTTTTTAATTCTT
CTATTTTGCAATTTAAATTTTAGCAAAATCTTAATTTTCAAACTCGATTTATTTTAACAC
TTAAAAAAATAAAAGATGGGAATGTCTTATTTATCTTAGCCTTCTTAATAATAACAGTCG
CAGCAGCTTCCAATTTCTCATTAGAATTAACAATATTCAGCTGCTGATTACCAACATCAC
CAGTAATAATACCAAAGTAATTTACTCTTTATTTAACTTTATTATTACAATATTAAAAAT
ATCTATCTGCTTACAATTTTAATTAAACCTTAAAAATTAGATCCTCTCGTGAATTAATAG
CATTCACAAGTCCAGTAATATTAGCAGTACACACAAAGTTAACTTTAGAATCAGTAACAA
CCTCAACAACAAACTCCTCATAGTGGTGCTATCTTATAGCAATAATAATAGCAATAACCA
CTTACTCCTAATCACTACCAATAGTATCAATACTTACTTTTGAAATGCTTAATTTTATTT
TAATTCTTAAATTTCCAAAATAGAAATTCAGTTTTCTCTAACTAGAATCACCTAGGCCAT
TAACACCCATCTTAGGCAGTATAGCCATAACAGGCTTAGCCTCCTGCTCATTAACACATT
TTAGATTAATAACCCCATCATTCTGGAATTGTTATAAATAATTCTTCTATGTATTTTTAA
CTTTTCTTGTAAATCTATCTTCATTTATCTAAATAATTTATGATAAATAAAAAAGGTATA
ATTAACAGCAACAGCCACAACATTAAAATCAGCATTTAATAAATCAACAAGGATATCAAT
AATAGTAGTAATAACCCCAATAATAGTAATAACAATAGCAACCACATATTCCATAGTCAT
AGCCACCTCCTCCTCCATCCTAAAATATGCTTCTGTCTCCTAATATCAATCCTATTTAGA
ATCCTCATCTATAACAATAGACTCCACTAAGTGCAGCTCGTTCTATTTAAACTCCTTAAT
AAATATACTAACAGCCTCCTTAGCTCCCATAAATGTAATAACTGAATAGCAATTAGAGCA
ACAGTGGTATTCTTTACTAATAAAATTACAACTAATAATCGCATCACATTCAGGTTCCAC
AAACTTAACCTCCACCACCTCCTTAAACTCAGTAGCATACTTAATATACGAATCAATCTT
TCAGCAGCATGAATAATAACTATGTAGCAAACTAGTTAATTAATGTTTTAAACTAAGTAA
ATTAGTTAGAACTCAATACTTGCAATAAAGTTGTAGAAGCAACAAATTCACTATATGTGG
ATGGTAATTTCTTAATTTTTAAATAATTCATTTTATTTAACTTTTAATATTAAATTAAAT
TAGGAGTACCTATAGATTCAAACGAAAGGGAAGTTTCACGTACATTCAAATTATATCATA
GTTACACTTTATTTATTTTATTTTTAAAATTAGACATTTTTAGGCCTTTCCCTGGATTCT
AAGCTGTAAGATTAATAAGAAAGCGCACATAAGCAGGAAGAGAATTTTATTTTTGTTTTG
TCGACTTTGAAAGTGCTCTTTAATCAACAATAGCATTAAGAACTTTACAAGTAATTAATA
GGATTTGTTTAAACTTATTGAAATATGATTAAAAATTATAAAAAGGGATACAGATTTGAT
AAAAAAGACACACAAGGACTGAAAATTTCATACGCAAACGAGCCTCACTAACCAAAAAAA
CAAGAATAGTTTGGAGTAAATAATAATTAACTGAATTTAAACTAGTCTTACTCTTAAACT
AGTATTCAGCTCGGCAGCACAGAAAATAATAGTATAAATAATAGCTATCAAATGAATTAA
TAAAATTATAATAATTAAAACATTCACTAAAAAGTTAATAATAATACTAATTCTTCTAAT
AAGCAAAAAAACAACTTCAACAAACAAAGATAAAAAAAGTGA