Identifiers and Description

Gene Model Identifier

TTHERM_00267920

Standard Name

RRM54 (RNA recognition motif-containing protein 54)

Aliases

PreTt09827 | 24.m00258 | 3690.m00072

Description

RNA recognition motif-containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF02370 ) M protein repeat
  • ( TIGR01612 ) rhoptry protein
  • ( PF02184 ) HAT (Half-A-TPR) repeat
  • ( PF00400 ) WD domain, G-beta repeat
  • ( PF00251 ) Glycosyl hydrolases family 32
  • ( TIGR01661 ) ELAV/HuD family splicing factor
  • ( PF05843 ) Suppressor of forked protein (Suf)
  • ( TIGR01622 ) splicing factor, CC1-like family
  • ( TIGR00864 ) polycystin cation channel protein
  • ( TIGR01659 ) sex-lethal family splicing factor
  • ( PF00053 ) Laminin EGF-like (Domains III and
  • ( PF04508 ) Viral A-type inclusion protein repeat
  • ( PF00076 ) RNA recognition motif. (a.k.a. RRM,
  • ( TIGR01642 ) U2 snRNP auxilliary factor, large
  • ( TIGR01628 ) polyadenylate binding protein, human types

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: Yes
Presense Probability: 77.5%

TetraMine Data

TTHERM_00267920

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_40952.19.997093137033517e-262hypothetical protein (2313 aa)
OxytrichaContig13604.0.g121.9992362000979228e-56hypothetical protein
Stentor CoeruleusSteCoe_86805.242885663363464e-22
DictyBaseDDB_G02750650.0000000020002373268528243dmpA on chromosome: 2 position
5096698 to 5101896
SGDYAL053W0.000009999254677478949FLC2 Putative FAD transporter;
required for uptake of FAD in
to endoplasmic reticulum; invo
lved in cell wall maintenance

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00267920(coding)
ATGTCGTATTTTATATAGCTCTCATTATTTTTATCAATTTTTATTTTTGAAAGAGTTATT
TGTTAGTGTGATGTTAAATGCTTATCATGCTCTGATGGGATATGTTAGTAGTGCATGGAC
GGATACACTTATAATTAATCTAATTATTCATGCTAATCGACATGTTAATATAATACATAC
AGAGATGATACTACAGGAACTTGCTAAAGTGTTTGTCCAACATCCTACTATAATAATAAT
AATTTGTATTCATGTATTTAATATCCTAACTGTCCTAACCTAATTGAGAAAGGTTAAAAC
CATTTTGATTTGGTTACTGCTGCTGCAGTTACTTAGAAGTTGATATTTGCAATAGGAATA
GTGAATAATAAACCTGTTATGTCAAATAACATCAAAGTATATTCAAGAGATGCTGAGTTA
TAAGGATAATTAGTAGGTCATTCAAATAGTATTATTGGAATTCAATCAATAACAGTTTAA
AATATTGTACAGCTTTATAGTTATAGCTCTACGGAACTAATTTTATGGGATGTTAACTTA
TGTTAAATGATAAGATATGGATTATTTGATTAAAACTTGCAAGCGAGTAGTATTTCGTAT
ATAGATTAAGATATTATTATCTTATAATAAGATAGCTAAACATTTGGTGTATTGCAATTA
AGCCAATTCAGAAATATAAGCTAAAGCTATTAGTCTACTCTTTTAGCAAACAAATAAATA
AATACTTTGACGGGCTTTACAAGGTTTTAGAATAATATTTACACTTTTTCTCAAGATGGA
AAACTTTATAGCTATAATTTAAATTCGCTATCTGATGGCTTACAAATAGCTGCGGTAAGT
AACCCAATACAGAGTGCAGTAGTTATATCTTAAAATAATATAATAATTATCTATGGACTT
AATGTATTGACATATTACAATGGATACAGCTCGAGTGTTGTTGATTTAGGACACACATTA
ACAATAAATAAAGTTCTTACTGATGTTGATTAGACTTTAAAGATTAATTATATTTTTACT
TTTGATGCTGCATCATTTAAATTTTCATATATAAATTCTAACAATCAAATTTAAGTGATT
GATTTCCGTAACATCAAAAAATCATTCTCTAAACTCATGAAAAGTTATTTAGTAACAATT
GATGCTTATGGTTAAATTATCATATACACGTATTCTAACATGATTCTGAAAGAAACTTTA
ACCTTAAATCTATCCTTTAAAACATATTTCGCTATTAGTGATGCATACATTGGAATAACT
TCTGAGCAAATGTACATTTTTGGAACAGAATTATTCTATTTGAATTTGATGGTGTAAAAA
TAACAGATAACTTTAGAAAGCCGTAATAAGAATATTCCAATTCGAATGACATAGCATACA
AGCAAAGTAAACGGTATAGTTTTTGATAGATTGTACAATAGAGTAATCACTTATTCTGAT
GATGGTTCAATTATATTTTATGACTAGATTGGTAATTAATATAAATTTGTTATGCAAAAA
TTCTATCCATCGACTAATTGTGATATGTTATAAAACACTCGTTGCTTTGTAGCAGTTAAT
GATTTATAAATTTTAAGACCTAATTTGTACTCTACAATTTACAGCAATGGTTCTGTAATT
TTGTATAAATACTCAGCACTTTCTTTTGATATGATCAAGCAACTTACAATGATAGATACA
ACACTCCCTATTTTAAATACTTACTTTGTTGGAAGTTTATTAGTATATTGCAATGGTAAA
GAAGTGAGAGTTTATGATGTAGATCAAGATCTAATTGTTCTAATATATGCTCCAGTCGAT
GCACTTAAAAATTATTTTTTACATTGTGCAACTGACTAAATAGGTGGAGTAAATTATCTT
ATATTTTCAAGAATTATTAATACATCCTATTTTATTATTGCTACTGATACGTTTTAAAAT
TTAGCCATTGCTAATTATGTAATTCCTTCTGCTTAATAATACAGTGTATTAAGAGATATT
TATATCGCCTAATATTTTAGTTCGATAAAGTGGTATATGGTAACTAATTCATAACTTTAT
CTATATTTTTCAACTTTTCCTAATTTTAAAACAACAACTATTTCAGTATATTAAAATCTT
CCAGTTTCTGTAGCTTTTGATCCTAATTCAAGATCTTTCACAGTCTTTTCTATGAATTAA
TACATGTCTTACTACTTATACAGTAGCGGATCATATGTTAAATAAAATACTTTTTAATTT
GCTGCATTTGCTACAGGTAAGTAGTCTACAGCCATATCATTTCCAGAACTTTATTTTAGT
TTTTAAAATACTGGTGTTAGCACAATACAGAATCAGGTATTTGTCATGAGACCTAATTTA
AATTTTTAGCTCGTTCTAACATTTGTTGACAAAATCTCTTCTATAAATGTAGACACAGTA
ACAAAAAAGCTGTATATTGGATTTGAAAATGGTAATATCTACAATGGAAATTATCTGGAA
AACTACGTTCTTTTTTAACAATAAGTAAATTACAATAATTTTTATTACTCTGATCAATCA
GACCTGCTGTTTGCATACAATAAAGCCATAAGCGTCATTGATTCTACATAACTCTAATAA
ACTGCCACCTTATCAGATTCAAATATGATAAGCAATTTAAATGGAGTGCTTTTTATTGAT
AGTACTTAGTAGCTAATAGCATATAATAGTGATAAAAATAAAAATTTAGTTATGTGGGAT
ATTAAAAGTAATACAAACTAGTAGTTTATGAATGGTCATACTACAGCAGGAGTAGTAAAT
GCACAGCTAGATATATAAAATAGTTTGCTTATTAGCTAAGGAGCTGATTTTTTTATTATA
ATTTGGAACTATTTAACCTTAAGCTAAGTTTACAGAATTTAAGACCATGTAAATGCAATG
AATGCTTTGAATTTAAGCTAAGCATCTATTCCAGCTGCTTATCAAATTTAATATTAAATT
ACACTTTTTATAGTTGATACTATTAACAAAGTTATTGTTAGCGCTAATAATTTAGGTACT
ATATTTGTGCATAGCTATATCACATTCACATCACAATCCTACAATATTACCTCAATGACT
TATGTTTATGTTGATAATATATATAACCATATTATTGCTGCTTCAAATAATAATTTCATC
TACAAGCTAACCATTTTAAGTTATACTTCTTCGTCTTTAACTTATTTCAAAGACGTTACA
AATGTTCATACAGAGTAGATCCTAGGAGCATTAATTTAAAATAATAATGTTTATTCTTTT
GAAGAGACTAAAATTGTTGTCATGGATAGATAAACCTTAACAGTTAAAAACACTATAGTT
TGTGTTAATCCTTTAATCACTAACTTTATAGTTTATGAAAAACTAAATCAAGTAATTATT
TGGAGTGATGCATAGACCAGTATTTTAAATCAAAGTATTGGCATATATAATCTTTTAACT
GGAGCTAAAATATAAGATATAAATAATAACCAAGTAATTGAACAAGGCAATATTCATAAA
TTAATAGTAGATTAAGACACTAATTAATTGATTATATCAAAAGTATATACATACAATTAC
ATTTACACAATTGATTTATAAACTTTTTACTACTCAGGTTATTATACTCAAAGTTACACT
GGGTATATTAAGTAGTGGTAATTTATTCCTAGGACTAATAGGCTTATCTATATAGACTCA
GCTTCTCCATCTAATTTATAGATATATAACATGGAAGGATCCATTAATTTAATTAAGAAA
TTTTAGCTCATTTCAGATGAAAAAAATGCTAACACACTGTTTAATTAACAAACTTAAAAT
ATTTATTATTTTGATTCCCTTAATCAGTCTTGGAAATATGATCGTAATTAATAAAAGTTA
ACATTCCTTAACAACAATGATTAAATAAAAGCTTCAAAGTTCTTCTAAGACTATTTCTAT
GTTATTACTGCTTCTTAAGTACTAAAGTATACTTCAGATCTTTTGTTGATAAGTTCATTT
AATTTTTAGACTTATTAATGCTTTTTTACAAATCTCTACTTATACCTTCTTGATTTTAAT
TATAATTTTATCTAATTGGCACTCACCAGCTTCGTTTAGCTTCCATTTTAAAGATAATTA
GAGAATACAATAAAGTATTTTTTACCTAATGAGAATTATCAAGATGTTGTTATCATGTTA
GTTACACAGAAAGTTTATAGATTTAATATGTAAAGTGGAAACACAATTTATAGCAATTCC
TAAGTATAAAATCTACAGATGATCGCTATGGATAGTAATAATTAGATAATAATCTATATA
TTTTATCCACAAACAATAAATTTTTACTCATACCAATAAAAAGTACAGGATTACACACAA
AATCTACTTTAAACCATTAATAATGGATTTTCTATATTTAATGTTATGCTTGATTATCAA
CAAAATACTTTCATTACAATATCAATATACGATGTTGCTCCTATTATACGTATTTACTCA
TACGTATTTAATTAAAACTCTCTTCAACCTATTACTTTAATATCTAGCATTCCATCTCCA
TCAAGATCTCCTAACTAGAAAATAGATTTGTCAGATCCAACTAAATTATCAATAGTTTTA
CCTTGGCAAATCATTAACTATGACAGAATTACTTATAAATTTGTAAGCTATTTTAGAGAT
ACATAAGTAATTTACTCTCTAATAAATTAAGGTACTCTTAATGGCTTTCCTAGCTTGCTT
AATTCAGTATAGAGCGATAGCATATAGCTATATTCCTAAGTGAATAATGTATTTGCTTAA
CCCTCATTATTTAAATTTCCTTTATCATACCCTGTGGTATTAAGTTATACAATTAATAGA
AAAAGCATATATTACTAAATACAGATAGCAGGGATAAGTACATAATTCATTTTTGATTAC
TCATTCTAGATACCAACATCTCAAAATACATAGTTTAACAATTGCTTTTAGAATATAAAT
GGGACGTTTAAGTACACAGTTGACATGTAAATGATGACACTATAAAATTCAATAAACAAG
TTGAATTTTAATCTATCAAGTAGCTTGATATAAGTTGATGCCCAAAATGCTTTCTTTTAT
CACTCATTGATGACTTCTTATAATGCAAGTGTCATTTATTAAAATTATAGTTCAAATCCT
CCTACTGTAAAAGTTACAAGCAATTTATTTTCAAATATTGGTTTGGATTAAATTATTATT
GACAACTATGTTTTGGATATTTCAAATGGAGGATAAATCAAACTAAATACTAATGCAAAT
AGATTGGTTTTTAAGTCAATTCAAATTGTTGGAAATTCATAAAACTTTTCATTTTTATTT
ACTAACCTATAGAGTGTGATTATAGAAAACATTTTAATAAATAACCTGATACTAAGTGGA
TCGACGGTATTATTTAACATTACTTCATGTCAGTCTGTTTACATCAAAAACTTTAGAGTG
AGATCTCTTAGTTTAGGTAATAATGCCTAGCTGTTTTACATTAGAAGCATATCTTAATAG
CTTTTAATAGAAAATATGAGTATAAATTACTTGTCTGTTGATTATTTACAGCAATAGAAT
TTTGTGATTGGACTAATTAATATCGCAATGGCTTAAATAATTAACTCACATTTTTCTTAA
TATGTGGCTATAAATTCGTAAAAGCCCTTCTACTTTATATCATTATAAGGAATCTAATAG
TTAACAATCAGTAATGTATAATACACTGATTCAATAGCTTTTGGATTTATTCAATATAAA
AACTACTATAGAGATAATTAACAAATAGTTTATCTTCATAATGATGTATTTTAAATAAAA
TCAAGCTAATTTAATAACCACTTTTACTTGAACTCCCCTTTTATTAGTATTGAAGGTAAC
TCAATAACATTTAATCACACTTAATTTTAGTATATTGAGTGCTTTACTTGTTCAGGTACT
GTTATTTCCTTAATATCTGTCTAAAGTTAATTTTTGGTAGTTTTTAGCATATTTAATAAT
ACAGTTGGCGAATAAGGAGGAGCTATTGCATTCTTAAATAACTTAAACGTTAGTTTAACA
ATTTAAGACTCTACTTTTTTGAACTGCACTGCATAAGCAAGTGGAGGAGCCATTTTTTTA
TCATCTAGTGATTTATTATTAAATCGTACTACAATTTAATTATGCTAAGCCTAGATAGGA
GGAGGTATAAGATACATAGGGTTAGAACCTATCTTCATTTACTATTAAAGAAAATACTTA
TCTTAGAAAGATAAGAACTTTTTCATAAGTAATGATATAAGTAATAATTATGCTTCTATT
TATGGATAAAATGTAGGCTCATATCCTAAAATGATAAAGATTATAGCCTAGACAAATCTT
TCGCAATAAACTTACAATAACAGCTTAGACACTGATACATTTAATTTAGATTTATATTTG
CTACAAAACTTTTAAAGTGGAGCAGATATCAGCTTTTAATTTTAAATTTTAGATTAGGAT
AGTAATCCAATTTTTTTTGATCTAAGTGCACTATAAAATAACTACTACCCTGATTCTATT
ATATAAGAGATATAGTAGTTCAGCATCAAAGCTCTTCCTGGAAATGATAATATTAAAGTA
TTCGGTTAATATATTACTGACTACACTTAATTTAATTTGGACACTAAAACTTTTACAATT
ACTTCAATGCTTATTATAGGATAACCATCAAGTACAAATTATATTTTATTTGAGAGTCCA
TCAATTTAAAAGATTTTAAATCCAGACACTGATAGAGATTTTAACGCAGGTCCCTTTCAC
ATCAGACTAAATATTTAGTTTAGAAAATGCTTAAGAGGAGAAGTCTACAAACTCAGTGGA
AGTATATTCTATTGCTAAGAGTGTAAAGAAGGCACTTATTCAATAGTTTAACCAATTCAA
GATGATTATGATACTCAGCTATGTTTAAGATGCCCTGATGAAGCTAGCTACTGTTACAGA
GATTAAATGGAACTAAAGTCAGGATATTGGAAGTATAGCAATGATACAGATTAAATTGTT
TATTGCTCTAACTAACCTGAAAATTGTAATGGCGATTAACTACATGATTATTGTGTAGAA
GGACATATAGGTCCATAATGTGAATAATGCGATATTTATGGTAATATGTGGGAAGCTGAA
TATTAATCAGATGGTAAGTTTAGCTGCATCAATTGCACTGAACTAAGATAGCCAAAATAC
TTATTCCCTATGATATTTATTGCTTTAGGAATGGTTATTTATATTATTCTAAGTGTTCAT
ATTGCTTACGAAATAAATACACTTATAGTACAAGGATATTACTTACGATAATTAAATCTA
TTAAGTATAAATAAAAGTGCTTATTAAGACACTACCAATATGAATATTAAAGCAATGGTA
AATTACATGTAGATTAGTTCTATGGTCAACACTTTTGTGGTCTAGTTACCTTCATGGATG
ACATTTATTCCAGATTATTTTGGCTCACCTATTTAAAATATGCTGCATACATTTGATTGT
TACTTAAACAAGGCACAATAGTCAAAGTATCCTATTGTTTTTTTAAGAACTTTGTGGAGC
TTGGCTATTCCTATATTTTATTTGCTAGGGGCAGGTGTCATTTATTTCATATTAGTCAAA
TTAAAGCTTTTTAAATATAGATAGTCTTATATTATCAGTGGTTTGGTATTCTTATGCTTC
TTTACATAGCCAAATATGGTGTCTGATCTATTAGGAGTAATGTCTTGTAGAGATATTGAT
GGTAAATTATATATATCTTCAGATATTTCCTATGAGTGCTACACTTAAATTCATGTAATC
TATATTGGAATTGTTTGTATACCTGGCTTAATTCTTTGGGGTTTAATGATACCAGCCTTT
ATAATTAGATTGCTTGTTTCAAACAAAGAATATCTTGATCATGCAACAATACGTCTCAAG
TATGGCTTTTTATATTAGGATTATAAAAACAGTAGATATTATTGGGAGTTTTTAAAGATG
TATAAAAAACTTTTTGCTGTGGCAGTCTTAAGTTTTTATGGGAATCCATACACAAATAAG
TTGGTTATTATATTAGTTGTTTATTTGCTTTACCTTGTAGCCTTACTCCGTTTTAGGCCC
TATTAGATGCAATATTTTTAGAAAATTGATAGAGCTAGTATGATTGTAACTATAGTTATT
CTTTTAATGAACATCTTTCTGTATAATAAACCAGACATGGTTTAATAAGAATTATTTTAT
GTTATCATTATCATTTTACATAATTCATATTAATTTTTTTTGCTTCTGGAAGTTTGTAGA
GCTAAAATTTCAGTCATCTATAGAGTCAGATATAATCAATTTTTAAAATGGCTTGTTACT
AAAATACCGTTTTTGAAGCCCTATATTGTAATAAATTAAAGAACTTCTATGAAAACTTTC
CACTTATGGATGAAAATCACTTATTATATTAATGAGTATGCTGAAAGAAAATAATATAAC
GAAATAGATTAGGTCAATTTGATAGGCTCAATGTCCTAAAGCAAGGAATTACATAATTAG
AGCTTCTTACCAAGTAAAAGAAATAGAATTAGAATGTAAAACAGCAATACCTTATAACCA
CTAAAAGGTGGATAAATTTAGCAATCAATAAGACTGGATAACCATAATCCTATTTAAGAT
GATTATTCATAAAGACATTCTTTTCAGAAAGATTAATTATTGTCTGCAGATAGGCTTGAT
CCTCATTTTTTAAGCCCTAAAGGATCGTCAAATAATTTGCTATTTTTATCAGCAAGAAAG
GATGAAACTTTTAAAAGCAATGGAAATTATATTGAATTTGATGATATTTTACTCTCTCCT
TCAAGAAATACATTACTGCAATCTCCTGTTTCATCTTTAAGGTAAGATAAAAGCGAACTT
AATCATTATGGGGAGATAGAAGAAGCTGAGGATGAAAGAAGGCTTATAAAGAAAAAAGGA
ATTAATTATGATCATAATTTATATTAAAAAACTGATTTAATAAAAAAAAATTTGATCCTT
ATAGATACATATTTCAATAATTAAGTAGAATAAAAGTTTAATCAACTATAAAAAGTATAA
GAAGCAAATATAGATGCTGAAACTCCAGATATAGACGAAAGTATAGAATTACAAAAAGAA
GTCCTTGTTAATTCATTAAGAAACACAAACACTTTAGCTCCTAGATTCTAAATTAGCCAA
ATATAACAAGAAGATAAAGACTTTACTCCAACTCCAAATTAAGAAAATGCAAAATAACTT
ATTGATCTAAACGAGAGTGATGATGATGAAGATGCATAATAAAAATAGGAGAAGATGGAA
AAGAAAGAGGAAGAGGAAGATTATAGGAGAATTTAAACTAAGAGTCAAATAAATCATGTC
CTAAATGTTTAAAGGAAAACTAATATCATATATAAAAATCTAAAGAAAGTAGAATGTTCA
GATTTAAATTGTTTGTAAAATTCAAATTCAAATGAAAAACAAAATGAAAATATTTTAGAA
ACTGAAGAAGATTCTTCTAAGCCTTAGGATCAAAATTTGGTATAAAAATAAAAAAGTTTT
CAAAATCAATAATCTCTAGAATCTATTTCACAAATAGATTCAATGTCTTCAAAATAAATT
ATTGACCCGTCTTAAAAAGATATTAAAAATGTAATATAAGCTCGTCCAAATGCGTTATTG
GGTAGTCCTTAAATTGAGAAAATAGTAGAAAGAAATAATAGTTTATCATAAAATTTTCTC
TTGCCATAATAAAGTTTGTAAAAGCAAGAAACAGAAATAAGCATGTCTAAAGAAATATAA
AATATAATTCAAAATAAAGCTATAACCGCTGAGAAAATGATTAAAGAAATCCATGATTGA


>TTHERM_00267920(protein)
MSYFIQLSLFLSIFIFERVICQCDVKCLSCSDGICQQCMDGYTYNQSNYSCQSTCQYNTY
RDDTTGTCQSVCPTSYYNNNNLYSCIQYPNCPNLIEKGQNHFDLVTAAAVTQKLIFAIGI
VNNKPVMSNNIKVYSRDAELQGQLVGHSNSIIGIQSITVQNIVQLYSYSSTELILWDVNL
CQMIRYGLFDQNLQASSISYIDQDIIILQQDSQTFGVLQLSQFRNISQSYQSTLLANKQI
NTLTGFTRFQNNIYTFSQDGKLYSYNLNSLSDGLQIAAVSNPIQSAVVISQNNIIIIYGL
NVLTYYNGYSSSVVDLGHTLTINKVLTDVDQTLKINYIFTFDAASFKFSYINSNNQIQVI
DFRNIKKSFSKLMKSYLVTIDAYGQIIIYTYSNMILKETLTLNLSFKTYFAISDAYIGIT
SEQMYIFGTELFYLNLMVQKQQITLESRNKNIPIRMTQHTSKVNGIVFDRLYNRVITYSD
DGSIIFYDQIGNQYKFVMQKFYPSTNCDMLQNTRCFVAVNDLQILRPNLYSTIYSNGSVI
LYKYSALSFDMIKQLTMIDTTLPILNTYFVGSLLVYCNGKEVRVYDVDQDLIVLIYAPVD
ALKNYFLHCATDQIGGVNYLIFSRIINTSYFIIATDTFQNLAIANYVIPSAQQYSVLRDI
YIAQYFSSIKWYMVTNSQLYLYFSTFPNFKTTTISVYQNLPVSVAFDPNSRSFTVFSMNQ
YMSYYLYSSGSYVKQNTFQFAAFATGKQSTAISFPELYFSFQNTGVSTIQNQVFVMRPNL
NFQLVLTFVDKISSINVDTVTKKLYIGFENGNIYNGNYLENYVLFQQQVNYNNFYYSDQS
DLLFAYNKAISVIDSTQLQQTATLSDSNMISNLNGVLFIDSTQQLIAYNSDKNKNLVMWD
IKSNTNQQFMNGHTTAGVVNAQLDIQNSLLISQGADFFIIIWNYLTLSQVYRIQDHVNAM
NALNLSQASIPAAYQIQYQITLFIVDTINKVIVSANNLGTIFVHSYITFTSQSYNITSMT
YVYVDNIYNHIIAASNNNFIYKLTILSYTSSSLTYFKDVTNVHTEQILGALIQNNNVYSF
EETKIVVMDRQTLTVKNTIVCVNPLITNFIVYEKLNQVIIWSDAQTSILNQSIGIYNLLT
GAKIQDINNNQVIEQGNIHKLIVDQDTNQLIISKVYTYNYIYTIDLQTFYYSGYYTQSYT
GYIKQWQFIPRTNRLIYIDSASPSNLQIYNMEGSINLIKKFQLISDEKNANTLFNQQTQN
IYYFDSLNQSWKYDRNQQKLTFLNNNDQIKASKFFQDYFYVITASQVLKYTSDLLLISSF
NFQTYQCFFTNLYLYLLDFNYNFIQLALTSFVQLPFQRQLENTIKYFLPNENYQDVVIML
VTQKVYRFNMQSGNTIYSNSQVQNLQMIAMDSNNQIIIYIFYPQTINFYSYQQKVQDYTQ
NLLQTINNGFSIFNVMLDYQQNTFITISIYDVAPIIRIYSYVFNQNSLQPITLISSIPSP
SRSPNQKIDLSDPTKLSIVLPWQIINYDRITYKFVSYFRDTQVIYSLINQGTLNGFPSLL
NSVQSDSIQLYSQVNNVFAQPSLFKFPLSYPVVLSYTINRKSIYYQIQIAGISTQFIFDY
SFQIPTSQNTQFNNCFQNINGTFKYTVDMQMMTLQNSINKLNFNLSSSLIQVDAQNAFFY
HSLMTSYNASVIYQNYSSNPPTVKVTSNLFSNIGLDQIIIDNYVLDISNGGQIKLNTNAN
RLVFKSIQIVGNSQNFSFLFTNLQSVIIENILINNLILSGSTVLFNITSCQSVYIKNFRV
RSLSLGNNAQLFYIRSISQQLLIENMSINYLSVDYLQQQNFVIGLINIAMAQIINSHFSQ
YVAINSQKPFYFISLQGIQQLTISNVQYTDSIAFGFIQYKNYYRDNQQIVYLHNDVFQIK
SSQFNNHFYLNSPFISIEGNSITFNHTQFQYIECFTCSGTVISLISVQSQFLVVFSIFNN
TVGEQGGAIAFLNNLNVSLTIQDSTFLNCTAQASGGAIFLSSSDLLLNRTTIQLCQAQIG
GGIRYIGLEPIFIYYQRKYLSQKDKNFFISNDISNNYASIYGQNVGSYPKMIKIIAQTNL
SQQTYNNSLDTDTFNLDLYLLQNFQSGADISFQFQILDQDSNPIFFDLSALQNNYYPDSI
IQEIQQFSIKALPGNDNIKVFGQYITDYTQFNLDTKTFTITSMLIIGQPSSTNYILFESP
SIQKILNPDTDRDFNAGPFHIRLNIQFRKCLRGEVYKLSGSIFYCQECKEGTYSIVQPIQ
DDYDTQLCLRCPDEASYCYRDQMELKSGYWKYSNDTDQIVYCSNQPENCNGDQLHDYCVE
GHIGPQCEQCDIYGNMWEAEYQSDGKFSCINCTELRQPKYLFPMIFIALGMVIYIILSVH
IAYEINTLIVQGYYLRQLNLLSINKSAYQDTTNMNIKAMVNYMQISSMVNTFVVQLPSWM
TFIPDYFGSPIQNMLHTFDCYLNKAQQSKYPIVFLRTLWSLAIPIFYLLGAGVIYFILVK
LKLFKYRQSYIISGLVFLCFFTQPNMVSDLLGVMSCRDIDGKLYISSDISYECYTQIHVI
YIGIVCIPGLILWGLMIPAFIIRLLVSNKEYLDHATIRLKYGFLYQDYKNSRYYWEFLKM
YKKLFAVAVLSFYGNPYTNKLVIILVVYLLYLVALLRFRPYQMQYFQKIDRASMIVTIVI
LLMNIFLYNKPDMVQQELFYVIIIILHNSYQFFLLLEVCRAKISVIYRVRYNQFLKWLVT
KIPFLKPYIVINQRTSMKTFHLWMKITYYINEYAERKQYNEIDQVNLIGSMSQSKELHNQ
SFLPSKRNRIRMQNSNTLQPLKGGQIQQSIRLDNHNPIQDDYSQRHSFQKDQLLSADRLD
PHFLSPKGSSNNLLFLSARKDETFKSNGNYIEFDDILLSPSRNTLLQSPVSSLRQDKSEL
NHYGEIEEAEDERRLIKKKGINYDHNLYQKTDLIKKNLILIDTYFNNQVEQKFNQLQKVQ
EANIDAETPDIDESIELQKEVLVNSLRNTNTLAPRFQISQIQQEDKDFTPTPNQENAKQL
IDLNESDDDEDAQQKQEKMEKKEEEEDYRRIQTKSQINHVLNVQRKTNIIYKNLKKVECS
DLNCLQNSNSNEKQNENILETEEDSSKPQDQNLVQKQKSFQNQQSLESISQIDSMSSKQI
IDPSQKDIKNVIQARPNALLGSPQIEKIVERNNSLSQNFLLPQQSLQKQETEISMSKEIQ
NIIQNKAITAEKMIKEIHD


>TTHERM_00267920(gene)
ATGTCGTATTTTATATAGCTCTCATTATTTTTATCAATTTTTATTTTTGAAAGAGTTATT
TGTTAGTGTGATGTTAAATGCTTATCATGCTCTGATGGGATATGTTAGTAGTGCATGGAC
GGATACACTTATAATTAATCTAATTATTCATGCTAATCGACATGTTAATATAATACATAC
AGAGATGATACTACAGGAACTTGCTAAAGTGTTTGTCCAACATCCTACTATAATAATAAT
AATTTGTATTCATGTATTTAATATCCTAACTGTCCTAACCTAATTGAGAAAGGTTAAAAC
CATTTTGATTTGGTTACTGCTGCTGCAGTTACTTAGAAGTTGATATTTGCAATAGGAATA
GTGAATAATAAACCTGTTATGTCAAATAACATCAAAGTATATTCAAGAGATGCTGAGTTA
TAAGGATAATTAGTAGGTCATTCAAATAGTATTATTGGAATTCAATCAATAACAGTTTAA
AATATTGTACAGCTTTATAGTTATAGCTCTACGGAACTAATTTTATGGGATGTTAACTTA
TGTTAAATGATAAGATATGGATTATTTGATTAAAACTTGCAAGCGAGTAGTATTTCGTAT
ATAGATTAAGATATTATTATCTTATAATAAGATAGCTAAACATTTGGTGTATTGCAATTA
AGCCAATTCAGAAATATAAGCTAAAGCTATTAGTCTACTCTTTTAGCAAACAAATAAATA
AATACTTTGACGGGCTTTACAAGGTTTTAGAATAATATTTACACTTTTTCTCAAGATGGA
AAACTTTATAGCTATAATTTAAATTCGCTATCTGATGGCTTACAAATAGCTGCGGTAAGT
AACCCAATACAGAGTGCAGTAGTTATATCTTAAAATAATATAATAATTATCTATGGACTT
AATGTATTGACATATTACAATGGATACAGCTCGAGTGTTGTTGATTTAGGACACACATTA
ACAATAAATAAAGTTCTTACTGATGTTGATTAGACTTTAAAGATTAATTATATTTTTACT
TTTGATGCTGCATCATTTAAATTTTCATATATAAATTCTAACAATCAAATTTAAGTGATT
GATTTCCGTAACATCAAAAAATCATTCTCTAAACTCATGAAAAGTTATTTAGTAACAATT
GATGCTTATGGTTAAATTATCATATACACGTATTCTAACATGATTCTGAAAGAAACTTTA
ACCTTAAATCTATCCTTTAAAACATATTTCGCTATTAGTGATGCATACATTGGAATAACT
TCTGAGCAAATGTACATTTTTGGAACAGTATGTCAATTATTATTTTTATCATAAATTAAA
ATATCTCATTTAAAATTACATTTCATATCAAAATTAAATTAAAATTTCAACTAATAATAA
ATTTTTATTTTAGGAATTATTCTATTTGAATTTGATGGTGTAAAAATAACAGATAACTTT
AGAAAGCCGTAATAAGAATATTCCAATTCGAATGACATAGCATACAAGCAAAGTAAACGG
TATAGTTTTTGATAGATTGTACAATAGAGTAATCACTTATTCTGATGATGGTTCAATTAT
ATTTTATGACTAGATTGGTAATTAATATAAATTTGTTATGCAAAAATTCTATCCATCGAC
TAATTGTGATATGTTATAAAACACTCGTTGCTTTGTAGCAGTTAATGATTTATAAATTTT
AAGACCTAATTTGTACTCTACAATTTACAGCAATGGTTCTGTAATTTTGTATAAATACTC
AGCACTTTCTTTTGATATGATCAAGCAACTTACAATGATAGATACAACACTCCCTATTTT
AAATACTTACTTTGTTGGAAGTTTATTAGTATATTGCAATGGTAAAGAAGTGAGAGTTTA
TGATGTAGATCAAGATCTAATTGTTCTAATATATGCTCCAGTCGATGCACTTAAAAATTA
TTTTTTACATTGTGCAACTGACTAAATAGGTGGAGTAAATTATCTTATATTTTCAAGAAT
TATTAATACATCCTATTTTATTATTGCTACTGATACGTTTTAAAATTTAGCCATTGCTAA
TTATGTAATTCCTTCTGCTTAATAATACAGTGTATTAAGAGATATTTATATCGCCTAATA
TTTTAGTTCGATAAAGTGGTATATGGTAACTAATTCATAACTTTATCTATATTTTTCAAC
TTTTCCTAATTTTAAAACAACAACTATTTCAGTATATTAAAATCTTCCAGTTTCTGTAGC
TTTTGATCCTAATTCAAGATCTTTCACAGTCTTTTCTATGAATTAATACATGTCTTACTA
CTTATACAGTAGCGGATCATATGTTAAATAAAATACTTTTTAATTTGCTGCATTTGCTAC
AGGTAAGTAGTCTACAGCCATATCATTTCCAGAACTTTATTTTAGTTTTTAAAATACTGG
TGTTAGCACAATACAGAATCAGGTTTATTATTACTTTATTATTAAAAAATTTTTAAATTA
TTTTTGTTCAAAAAACAAAAAATAAGGTATTTGTCATGAGACCTAATTTAAATTTTTAGC
TCGTTCTAACATTTGTTGACAAAATCTCTTCTATAAATGTAGACACAGTAACAAAAAAGC
TGTATATTGGATTTGAAAATGGTAATATCTACAATGGAAATTATCTGGAAAACTACGTTC
TTTTTTAACAATAAGTAAATTACAATAATTTTTATTACTCTGATCAATCAGACCTGCTGT
TTGCATACAATAAAGTAAATTTATCTTTTTTTAATTTAAATTTTAATAATATTTTAAATT
ATTTCTCAAAATAATTTATTTTACTTTCTTTTATAACACAAATCCTCAAAAATATAAATA
TTAATTAACTCCTAAATTTCTTGATTTTGAAAAATTCAAACATTTATTTTATGAAAAAAA
AGAGTAAAAATGTATTTTTTTATAAGCTTTCTACATTTGAAGTATTTTTTAAATAGTTTC
AAATTTAAACCTGGCTGATTATTAATATTACTAATTCTTATCAAAATAAATCTTATAGGG
TCAACTTCTATGCAATTAGCAATATAAATGCATGCTATTTTTCTATAATTTTTTATATTT
TATATTAGAAGGCATTTAAAAATAAATATTCAAATCAATTAAAATATATATTTTTCATTT
TAATTTAAAATTTTAATAATTAATTAAGGCCATAAGCGTCATTGATTCTACATAACTCTA
ATAAACTGCCACCTTATCAGATTCAAATATGATAAGCAATTTAAATGGAGTGCTTTTTAT
TGATAGTACTTAGTAGCTAATAGCATATAATAGTGATAAAAATAAAAATTTAGTTATGTG
GGATATTAAAAGTAATACAAACTAGTAGTTTATGAATGGTCATACTACAGCAGGAGTAGT
AAATGCACAGCTAGATATATAAAATAGTTTGCTTATTAGCTAAGGAGCTGATTTTTTTAT
TATAATTTGGAACTATTTAACCTTAAGCTAAGTTTACAGAATTTAAGACCATGTAAATGC
AATGAATGCTTTGAATTTAAGCTAAGCATCTATTCCAGCTGCTTATCAAATTTAATATTA
AATTACACTTTTTATAGTTGATACTATTAACAAAGTTATTGTTAGCGCTAATAATTTAGG
TACTATATTTGTGCATAGCTATATCACATTCACATCACAATCCTACAATATTACCTCAAT
GACTTATGTTTATGTTGATAATATATATAACCATATTATTGCTGCTTCAAATAATAATTT
CATCTACAAGCTAACCATTTTAAGTTATACTTCTTCGTCTTTAACTTATTTCAAAGACGT
TACAAATGTTCATACAGAGTAGATCCTAGGAGCATTAATTTAAAATAATAATGTTTATTC
TTTTGAAGAGACTAAAATTGTTGTCATGGATAGATAAACCTTAACAGTTAAAAACACTAT
AGTTTGTGTTAATCCTTTAATCACTAACTTTATAGTTTATGAAAAACTAAATCAAGTAAT
TATTTGGAGTGATGCATAGACCAGTATTTTAAATCAAAGTATTGGCATATATAATCTTTT
AACTGGAGCTAAAATATAAGATATAAATAATAACCAAGTAATTGAACAAGGCAATATTCA
TAAATTAATAGTAGATTAAGACACTAATTAATTGATTATATCAAAAGTATATACATACAA
TTACATTTACACAATTGATTTATAAACTTTTTACTACTCAGGTTATTATACTCAAAGTTA
CACTGGGTATATTAAGTAGTGGTAATTTATTCCTAGGACTAATAGGCTTATCTATATAGA
CTCAGCTTCTCCATCTAATTTATAGTAAATTATTATTTGAGTTTTTATTATAACAGTAAT
CTAAAATTTTAAAAATACTTTTATCAAATCATAAAACTAAAACTCTTTTAATAAATAATA
AATAGGATATATAACATGGAAGGATCCATTAATTTAATTAAGAAATTTTAGCTCATTTCA
GATGAAAAAAATGCTAACACACTGTTTAATTAACAAACTTAAAATATTTATTATTTTGAT
TCCCTTAATCAGTCTTGGAAATATGATCGTAATTAATAAAAGTTAACATTCCTTAACAAC
AATGATTAAATAAAAGCTTCAAAGTTCTTCTAAGACTATTTCTATGTTATTACTGCTTCT
TAAGTACTAAAGTATACTTCAGATCTTTTGTTGATAAGTTCATTTAATTTTTAGACTTAT
TAATGCTTTTTTACAAATCTCTACTTATACCTTCTTGATTTTAATTATAATTTTATCTAA
TTGGCACTCACCAGCTTCGTTTAGCTTCCATTTTAAAGATAATTAGAGAATACAATAAAG
TATTTTTTACCTAATGAGAATTATCAAGATGTTGTTATCATGTTAGTTACACAGAAAGTT
TATAGATTTAATATGTAAAGTGGAAACACAATTTATAGCAATTCCTAAGTATAAAATCTA
CAGATGATCGCTATGGATAGTAATAATTAGATAATAATCTATATATTTTATCCACAAACA
ATAAATTTTTACTCATACCAATAAAAAGTACAGGATTACACACAAAATCTACTTTAAACC
ATTAATAATGGATTTTCTATATTTAATGTTATGCTTGATTATCAACAAAATACTTTCATT
ACAATATCAATATACGATGTTGCTCCTATTATACGTATTTACTCATACGTATTTAATTAA
AACTCTCTTCAACCTATTACTTTAATATCTAGCATTCCATCTCCATCAAGATCTCCTAAC
TAGAAAATAGATTTGTCAGATCCAACTAAATTATCAATAGTTTTACCTTGGCAAATCATT
AACTATGACAGAATTACTTATAAATTTGTAAGCTATTTTAGAGATACATAAGTAATTTAC
TCTCTAATAAATTAAGGTACTCTTAATGGCTTTCCTAGCTTGCTTAATTCAGTATAGAGC
GATAGCATATAGCTATATTCCTAAGTGAATAATGTATTTGCTTAACCCTCATTATTTAAA
TTTCCTTTATCATACCCTGTGGTATTAAGTTATACAATTAATAGAAAAAGCATATATTAC
TAAATACAGATAGCAGGGATAAGTACATAATTCATTTTTGATTACTCATTCTAGATACCA
ACATCTCAAAATACATAGTTTAACAATTGCTTTTAGAATATAAATGGGACGTTTAAGTAC
ACAGTAATCAATTCTTAAATAAAAATTAAAATTTTTTTAAAATATTAATATCTTAAAATA
AAAAAATTTTTTAGAAAAATGAATCTAACAAATCTTCTTTTTTTTAATATTTTTTTTGAA
AAACATGTTTATGATAAATCTATTTTAATATACTGGATACTTTAAAAAATAAAAAAAAAA
ATCTTCATAAAAACTAAAAAATAATAAAATAAAATTCCTAAAATTGAAAAAGCAAATATT
TATTTTGAATAAAAATTAGGTTGACATGTAAATGATGACACTATAAAATTCAATAAACAA
GTTGAATTTTAATCTATCAAGTAGCTTGATATAAGTATAATTTTAATGAGCATAGTACTT
TTTTAAATTTATAATAATTAAAATAGGTTGATGCCCAAAATGCTTTCTTTTATCACTCAT
TGATGACTTCTTATAATGCAAGTGTCATTTATTAAAATTATAGTTCAAATCCTCCTACTG
TAAAAGTTACAAGCAATTTATTTTCAAATATTGGTTTGGATTAAATTATTATTGACAACT
ATGTTTTGGATATTTCAAATGGAGGATAAATCAAACTAAATACTAATGCAAATAGATTGG
TTTTTAAGTCAATTCAAATTGTTGGAAATTCATAAAACTTTTCATTTTTATTTACTAACC
TATAGAGTGTGATTATAGAAAACATTTTAATAAATAACCTGATACTAAGTGGATCGACGG
TATTATTTAACATTACTTCATGTCAGTCTGTTTACATCAAAAACTTTAGAGTGAGATCTC
TTAGTTTAGGTAATAATGCCTAGCTGTTTTACATTAGAAGCATATCTTAATAGCTTTTAA
TAGAAAATATGAGTATAAATTACTTGTCTGTTGATTATTTACAGCAATAGAATTTTGTGA
TTGGACTAATTAATATCGCAATGGCTTAAATAATTAACTCACATTTTTCTTAATATGTGG
CTATAAATTCGTAAAAGCCCTTCTACTTTATATCATTATAAGGAATCTAATAGTTAACAA
TCAGTAATGTATAATACACTGATTCAATAGCTTTTGGATTTATTCAATATAAAAACTACT
ATAGAGATAATTAACAAATAGTTTATCTTCATAATGATGTATTTTAAATAAAATCAAGCT
AATTTAATAACCACTTTTACTTGAACTCCCCTTTTATTAGTATTGAAGGTAACTCAATAA
CATTTAATCACACTTAATTTTAGTATATTGAGTGCTTTACTTGTTCAGGTACTGTTATTT
CCTTAATATCTGTCTAAAGTTAATTTTTGGTAGTTTTTAGCATATTTAATAATACAGTTG
GCGAATAAGGAGGAGCTATTGCATTCTTAAATAACTTAAACGTTAGTTTAACAATTTAAG
ACTCTACTTTTTTGAACTGCACTGCATAAGCAAGTGGAGGAGCCATTTTTTTATCATCTA
GTGATTTATTATTAAATCGTACTACAATTTAATTATGCTAAGCCTAGATAGGAGGAGGTA
TAAGATACATAGGGTTAGAACCTATCTTCATTTACTATTAAAGAAAATACTTATCTTAGA
AAGATAAGAACTTTTTCATAAGTAATGATATAAGTAATAATTATGCTTCTATTTATGGAT
AAAATGTAGGCTCATATCCTAAAATGATAAAGATTATAGCCTAGACAAATCTTTCGCAAT
AAACTTACAATAACAGCTTAGACACTGATACATTTAATTTAGATTTATATTTGCTACAAA
ACTTTTAAAGTGGAGCAGATATCAGCTTTTAATTTTAAATTTTAGATTAGGATAGTAATC
CAATTTTTTTTGATCTAAGTGCACTATAAAATAACTACTACCCTGATTCTATTATATAAG
AGATATAGTAGTTCAGCATCAAAGCTCTTCCTGGAAATGATAATATTAAAGTATTCGGTT
AATATATTACTGACTACACTTAATTTAATTTGGACACTAAAACTTTTACAATTACTTCAA
TGCTTATTATAGGATAACCATCAAGTACAAATTATATTTTATTTGAGAGTCCATCAATTT
AAAAGATTTTAAATCCAGACACTGATAGAGATTTTAACGCAGGTATTTTTTATTATTTCT
ATTACTTTAAAAATGTTTATTTGTAAATTAAAATATTTTCAAAGGTCCCTTTCACATCAG
ACTAAATATTTAGTTTAGAAAATGCTTAAGAGGAGAAGTCTACAAACTCAGTGGAAGTAT
ATTCTATTGCTAAGAGTGTAAAGAAGGCACTTATTCAATAGTTTAACCAATTCAAGGTAT
ATTTTTTTCTTATTTGTTGATCATCTTAACCCATAAAATTATTTACTTTTGAAAGATTAA
AGAGTAAAAATTATTTAATTATTTGTTAGATTATTTATTATATGTGTGTGATAATCTTTA
ATTAATAATATTTTATCTATTTTGTATTAGATGATTATGATACTCAGCTATGTTTAAGAT
GCCCTGATGAAGCTAGCTACTGTTACAGAGATTAAATGGAACTAAAGTCAGGATATTGGA
AGTATAGCAATGATACAGATTAAATTGTTTATTGCTCTAACTAACCTGAAAATTGTAATG
GCGATTAACTACATGATTATTGTGTAGAAGGACATATAGGTCCATAATGTGAATAATGCG
ATATTTATGGTAATATGTGGGAAGCTGAATATTAATCAGATGGTAAGTTTAGCTGCATCA
ATTGCACTGAACTAAGATAGCCAAAATACTTATTCCCTATGATATTTATTGCTTTAGGAA
TGGTTATTTATATTATTCTAAGTGTTCATATTGCTTACGAAATAAATACACTTATAGTAC
AAGGATATTACTTACGATAATTAAATCTATTAAGTATAAATAAAAGTGCTTATTAAGACA
CTACCAATATGAATATTAAAGCAATGGTAAATTACATGTAGATTAGTTCTATGGTCAACA
CTTTTGTGGTCTAGTTACCTTCATGGATGACATTTATTCCAGATTATTTTGGTATTTATT
TTTTTACATTCTTTTTTTTGTATTTATTTTCTTTTTATATAACATAAACCAGGCTCACCT
ATTTAAAATATGCTGCATACATTTGATTGTTACTTAAACAAGGCACAATAGTCAAAGTAT
CCTATTGTTTTTTTAAGAACTTTGTGGAGCTTGGCTATTCCTATATTTTATTTGCTAGGG
GCAGGTGTCATTTATTTCATATTAGTCAAATTAAAGCTTTTTAAATATAGATAGGTATTT
TTTATTCATCGATTTATTTAAAAATTACGAATTAATAAAATATATAATATTATAGTCTTA
TATTATCAGTGGTTTGGTATTCTTATGCTTCTTTACATAGCCAAATATGGTGTCTGATCT
ATTAGGAGTAATGTCTTGTAGAGATATTGATGGTAAATTATATATATCTTCAGATATTTC
CTATGAGTGCTACACTTAAATTCATGTAATCTATATTGGAATTGTTTGTATACCTGGCTT
AATTCTTTGGGGTTTAATGATACCAGCCTTTATAATTAGATTGCTTGTTTCAAACAAAGA
ATATCTTGATCATGCAACAATACGTCTCAAGTATGGCTTTTTATATTAGGATTATAAAAA
CAGTAGATATTATTGGGAGTTTTTAAAGATGTATAAAAAACTTTTTGCTGTGGCAGTCTT
AAGTTTTTATGGGAATCCATACAGTAAGAAAATTTAATTGAATGCTTTGAATTTTTTATT
TTGATAATTAATTTCTTCTCATTTTAATATATTTTTTATTTAGATAAAATGAGAAGAAAA
TATTTTCTTTTTTTATTTCATATTTCATCTAAAAAATAAGAACAGGATTATTTTAATAAA
TTACTTTATTGCATTGAATTTAACTTTATAATTTTAATTAAAAGCAAATAAGTTGGTTAT
TATATTAGTTGTTTATTTGCTTTACCTTGTAGCCTTACTCCGTTTTAGGCCCTATTAGAT
GCAATATTTTTAGAAAATTGATAGAGCTAGTATGATTGTAACTATAGTTATTCTTTTAAT
GAACATCTTTCTGTATAATAAACCAGACATGGTTTAATAAGAATTATTTTATGTTATCAT
TATCATTTTACATAATTCATATTAATTTTTTTTGCTTCTGGAAGTTTGTAGAGCTAAAAT
TTCAGTCATCTATAGAGTCAGATATAATCAATTTTTAAAATGGCTTGTTACTAAAATACC
GTTTTTGAAGCCCTATATTGTAATAAATTAAAGAACTTCTATGAAAACTTTCCACTTATG
GATGAAAATCACTTATTATATTAATGAGTATGCTGAAAGAAAATAATATAACGAAATAGA
TTAGGTCAATTTGATAGGCTCAATGTCCTAAAGCAAGGAATTACATAATTAGAGCTTCTT
ACCAAGTAAAAGAAATAGAATTAGAATGTAAAACAGCAATACCTTATAACCACTAAAAGG
TGGATAAATTTAGCAATCAATAAGACTGGGTAAATAATTTTTTTTTGATAACTCACATTT
AAATTATTTTTCTAAAACAATAGATAACCATAATCCTATTTAAGATGATTATTCATAAAG
TAATTCTTTAAATTTTACTAATTATTTTTTTTCTTTACACATGCTAATTTAATATTAAAT
TGAAGGACATTCTTTTCAGAAAGATTAATTATTGTCTGCAGATAGGCTTGATCCTCATTT
TTTAAGCCCTAAAGGATCGTCAAATAATTTGCTATTTTTATCAGGTAAATCTATTTATTA
TTTCACTATTTTTATATTTTGTGTTTAATTTATAGCAAGAAAGGATGAAACTTTTAAAAG
CAATGGAAATTATATTGAATTTGATGATATTTTACTCTCTCCTTCAAGAAATACATTACT
GCAATCTCCTGTTTCATCTTTAAGGTAAGATAAAAGCGAACTTAATCATTATGGGGAGAT
AGAAGAAGCTGAGGATGAAAGAAGGCTTATAAAGAAAAAAGGAATTAATTATGATCATAA
TTTATATTAAAAAACTGATTTAATAAAAAAAAATTTGATCCTTATAGATACATATTTCAA
TAATTAAGTAGAATAAAAGTTTAATCAACTATAAAAAGTATAAGAAGCAAATATAGATGC
TGAAACTCCAGATATAGACGAAAGTATAGAATTACAAAAAGAAGTCCTTGTTAATTCATT
AAGGTAAATTTGTTTAAAATATTATTCTCTCTTTTTTTTTAATGAAAATTTAGTTTTATT
ATAATTTTAAAACGAAATTTTATTAATAAATATTTAATATTAAATAAAAGAAACACAAAC
ACTTTAGCTCCTAGATTCTAAATTAGCCAAATATAACAAGAAGATAAAGACTTTACTCCA
ACTCCAAATTAAGAAAATGCAAAATAACTTATTGATCTAAACGAGAGTGATGATGATGAA
GATGCATAATAAAAATAGGAGAAGATGGAAAAGAAAGAGGAAGAGGAAGATTATAGGAGA
ATTTAAACTAAGAGTCAAATAAATCATGTCCTAAATGTTTAAAGGAAAACTAATATCATA
TATAAAAATCTAAAGAAAGTAGAATGTTCAGATTTAAATTGTTTGTAAAATTCAAATTCA
AATGAAAAACAAAATGAAAATATTTTAGAAACTGAAGAAGATTCTTCTAAGCCTTAGGAT
CAAAAGTAATTTATTTATTAACTTTTAACATATTGCTAGTTTAATTAAACTTTTTTTTTT
TCATATAAAAATGAAAATTATCATAAATATTCAAAAATAACTTTTAATTATGCTAAAAAA
TTGCTTTTATAAATAAAAACAATTTATTTTAAAATAAAATTTAGTTTGGTATAAAAATAA
AAAAGTTTTCAAAATCAATAATCTCTAGAATCTATTTCACAAATAGATTCAATGTCTTCA
AAATAAATTATTGACCCGTCTTAAAAAGATATTAAAAATGTAATATAAGCTCGTCCAAAT
GCGTTATTGGGTAGTCCTTAAATTGAGAAAATAGTAGAAAGAAATAATAGTTTATCATAA
AATTTTCTCTTGCCATAATAAAGTTTGTAAAAGCAAGAAACAGAAATAAGCATGTCTAAA
GAAATATAAAATATAATTCAAAATAAAGCTATAACCGCTGAGAAAATGATTAAAGAAATC
CATGATTGA