Identifiers and Description

Gene Model Identifier

TTHERM_00898250

Standard Name

RRM52 (RNA recognition motif-containing protein 52)

Aliases

PreTt20530 | 160.m00066

Description

RNA binding protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF00076 ) RNA recognition motif. (a.k.a. RRM,

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00898250

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_41364.11.0004671766404936e-76RNA binding protein (119 aa)
OxytrichaContig11357.0.g942.9994376937714457e-52RNA recognition motif_ (a_k_a_
RRM, RBD, or RNP domain)
WormBaseWBGene000168085.997418848378574e-45Pre-mRNA branch site p14-like
protein status:Confirmed U
niProt:Q8ITY4 protein_id:CCD
65337.1
DictyBaseDDB_G02862972.0008536325002377e-42DDB_G0286297 on chromosome: 4
position 4322636 to 4323120
Stentor CoeruleusSteCoe_174062.8625185805493937e-20
SGDYGL044C0.0000000006000548789370351RNA15 Cleavage and polyadenyla
tion factor I (CF I) component
involved in cleavage and poly
adenylation of mRNA 3 ends; in
teracts with the A-rich polyad
enylation signal in complex wi
th Rna14p and Hrp1p; mutant di
splays reduced transcription e
longation in the G-less-based
run-on (GLRO) assay; required
for gene looping

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00898250(coding)
ATGAGCAATAAGATTGTTAAGTTACCCCCTGAGGTTAATAGAGTAGTTTATGTTAGAAAT
CTACCATATAAAATATCAGCAGAAGAATTATATGATGTTTTTGGAACTTATGGTCCAATT
AGATAAATAAGAAAGGGAGTTAGTGGTGATAAAAAAGGAACAGCATTTGTAGTTTATGAA
GATATTTTTGATGCAAAGACTGCAGTTGAACATTTAAATGGTTTTAATGTTGCAGGCAGA
TATTTAATTGTTTTATATTATCAACCTCATAAAATCAACAAAAAGACTGATTTACAAAAG
AAATAAGAAGAAGTTGATCGTTTAAAAGAAATAGCAAGCAAATAAACTTAATAGTGA


>TTHERM_00898250(protein)
MSNKIVKLPPEVNRVVYVRNLPYKISAEELYDVFGTYGPIRQIRKGVSGDKKGTAFVVYE
DIFDAKTAVEHLNGFNVAGRYLIVLYYQPHKINKKTDLQKKQEEVDRLKEIASKQTQQ


>TTHERM_00898250(gene)
ATGAGCAATAAGATTGTAAATATTAGCATTAAAAAACCAATTTTATATTCTAAAATATTT
TAATTCAAATAGGTTAAGTTACCCCCTGAGGTTAATAGAGTAGTTTATGTTAGAAATCTA
CCATATAAAATATCAGCAGAAGAATTATATGATGTTTTTGGAACTTATGGTCCAATTAGA
TAAATAAGAAAGTAAATAAATTATTTTTATTCAAATTGAAAATAGCTAATTATTTTATCA
ATATTCAATAGGGGAGTTAGTGGTGATAAAAAAGGAACAGCATTTGTAGTTTATGAAGAT
ATTTTTGATGCAAAGACTGCAGTTGAACATTTAAATGGTTTTAATGTTGCAGGCAGATAT
TTAATTGTTTTATATTATCAACCTCATAAAATCAACAAAAAGACTGATTTACAAAAGAAA
TAAGAAGAAGTTGATCGTTTAAAAGAAATAGCAAGCAAATAAACTTAATAGTGA