Identifiers and Description

Gene Model Identifier

TTHERM_00444880

Standard Name

RRM51 (RNA recognition motif-containing protein 51)

Aliases

PreTt03856 | 51.m00222 | 3704.m00078

Description

RRM51 RNA recognition motif 3 in plant Mei2-like protein; RNA recognition motif 2 family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF04059 ) RNA recognition motif 2
  • ( PF07133 ) Merozoite surface protein (SPAM)
  • ( PF04259 ) Small, acid-soluble spore protein, gamma-type

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.3%

TetraMine Data

TTHERM_00444880

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_10866.19.996162112727537e-67RNA recognition domain-contain
ing protein 2 family protein (
1485 aa)
OxytrichaContig6775.0.g217.998336109808381e-38RNA recognition motif 2
Stentor CoeruleusSteCoe_81582.8625185805493937e-20
DictyBaseDDB_G02792558.997498379799854e-17DDB_G0279255 on chromosome: 3
position 1840170 to 1845388

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00444880(coding)
ATGAAGAATTAAAGCTCTAATAGTTCAGTAGATATAGAGATTAATTCACAGTGCTAAAAG
CCTTCTTAACAACTTTTAGGCCCAAGTATAATTTTGAAAGACCATCAGGAAGATAGAACT
AAAAGCAATTCTTCCTCATAGAACAGCACCTTCAGAAAGGTTCATTCAACTAAAGGCAAA
AATGAGAAAAGTAAAAGGCCTTCTAGTGTGACCCAAAGACCAAGTTCGATTCCAAAATTT
GTATCATCCTTTTCAAATGAAGCGCAAAAAATAGGTTTGAATGGAAATACAAGAAGTTAA
GATGATAGTTATGCAGTAAATAGTCTAATTAGTAGCATGAATAATAGTTATTGCATTCAA
TAGAATGCTCATGACATTTTGGCTAAATCTAAACTCCAAAATTCTTATCATTAACGAGGA
AGTTCATTGTAAGCAATAGGTTAAGTAAATGTATTTAGCACATAGTATTCAAGCAATCTT
AAAGGTGGATCTTCTCAATCTTTATAGAATTAAGTTGCTTAATCATAATCCCTAGCTAAC
AGCTTTGTATCTGTTAATCAGCAAGCAGTAGGTTCATCTGGAGATGAAAAATCTGGAGCA
AATGTTTGCTAATCTTTCTCTGCCGTCATCTCAGCTCAGCCTGTATCTGAACTTAAAATT
GCAGGTCCTGAGATTAATAACCTTTAAGTATCATCACAAAGTTAGCCATTATCTGATAAT
TTAGTATTTAAACACGCTTCGTCACTTGATCTCCCTCCTTAATCCTCTCTAAATGTCAGT
TCAAAATTAATTAATCAATAAGTAAATGCCGCTCATAAGTATAATAATCCCAAATAGCTA
AATGAGTAGTAAATTTTAAAGTCATAAAAGCACAAGTAAAAAAATATACTAGAAAATGAA
GAGGATTGTGATCAAAAAGATAAGTAAGAAGATGAAGAATAGAATGAGTAAAATGTATGC
GAATTATAGCAAGCATAGGGTATTGAAGCCTTCGATGTAGTAGCTAACAACAAAGCAGAT
TCTGAAAATTAGATGAGTTAAGTTTAAATATAAGGGAATAATATATTTGGAATAAATACT
GAGTTAGAAAAAATAGATCTCAATAATAGCAGCTCATCTAAGCATACTTCTAACTCAATA
ACATCAAGGTCACATAAAAATTAGTCAAATATCTCTGATGATTTTTTGTAGGATTCAAAA
TAAGAAAGTGTAAACAACAACAGTATGATTGTTAGCAGTAGCAATAATAGCAGCAGGGTT
TTTAAAGGATCAAGCAACAATAGCTTTATCCTAAATTAATGTACTTAAAAAGCAGCTGCA
TAAAATCCTTTAAACGAATTTATTCAATCCAAGGAAGAAATCAAAGAAAGCATAAGTAGA
TCTAAATATTGCGCAAAGCCTAGAGATGCTCATATACTTTAAAATGCAAGATTGCCTATC
AAGCCTATTTTACAAGATGAATCTAAAAATCAAATTCTAACTCTAGATGACAAGTTAATT
GCTCCTCCTTCAATTTAAGTAATATAAAAACCTAGCCAAGATTTAAATGAATCACAGTTG
AAAGGCAAACAAAAATTAAAATAACTTATGCATAGAAGAGGAAATACTTTAAGTAGAAAT
GATATAGAAGATTTGTAGTTCTTTGAGTTTTAAGACTCAGTCTTCCAAAAGGTTTCATCT
GAAGATGAAAAAGTAAATTCTAACTAATTGGAAAACAAGCAAACATCTCAGGAAAATTTA
AGCACAAATCCTCTTTCTTTTATCAACCCTTCCTAGGTCTATGACTTTTAGAATAAGAAC
AATGAAGAAGATAATCAAAACGAGCAAGACTACTAACAGGAAGATTAAGATGAAGATATT
GAAATCAAAAAATAAGTAGAACTGCTAAACAGTGACGACTCTGAGAACGAAGATAAGGTA
AGAAATATAGGTAAGCCCAGTCCTCATCCTCCTGTTGGTGTTTACTAATAACAAATTTAT
CATCCGATTCCTTAGCAATAATCCCAGTAATAAATGAGTTTTCATCCTCACTTAAATCCT
TTTGTTGATATCCCAAGCTAGTCCACTCCATAGATTCAATAACAAAATTTTGATTCTTTT
AGCAAGCAATCTTCTACTCCTAATCAACAATTAGAGTATATTAGCTCAAAGAGAATTGTT
GGCCCTAGACCAATGTCTATTGATTAGCAATTTTCTTAATTCTTTGCTACTCCTAATTAG
TAATAAATTATGAACATACCAGAAAAGTGTGGATCACCTTTATAATTTACTGATTACTCT
CAATAGTAAGGGTAGTCTCCTTACATCTTATACGAATCACCAGCACATTAACACATTCAA
TCTATTTATAACTAAGGGATGAAGTAACCTACAAATAATATGAATAATATTATTTAATTT
AATTAAATGAATACACCTTCTCCCCCAATCCAAGGCAACTAATAAAAGAACTATTAGATC
TTTTAGCAACACACTTAGATGTAATAAATGATGTGCTAAATTCCAGCATAACATAGTATT
GGTATCTAGTAGCCTTAACAAAATTAATAGGGTAATCAATAGCAATAGTAATAGGCTGGT
TAGATATTTAATTAGAACTAAATAAGCTTGGGATAATAGGGCTAATAATAAATGATGGCT
ATGATGAAGAACTAAAAGCAGCACTTGTAAATATAGCCTAACTCTTTGTTCTCTTCAAAT
TCAAGCTCTACATACCACTTGTAGAAATAAAATTGCAATCTATCTCAAGCATCAACAATA
GACTCAGCAGATTATATCAACACTTTCAGATCAGGATCTTCTTATGGTGTTTAGGATGTC
TAGTAAGATCAAGTAGTTAAGATGATTAAGCAATAGAGTTAGTCGATATAGTAATAACTG
CAAGTTAGAAGCTAATGTATTCAATCTCAAGTGCAGCAACAATAAAGCTAGCAAGGACCT
TAACTCAACTAGCAGCTAAACTTCTTCCCAAACCATCATCTCGCAAATTAATAAGAAAAA
GGTTTCTTTTAATAACCTAATACAAACGCAAATTAATTTTTGCTTGAACCTTTTACTTCT
TAACCTCAGTTTAATTAATATTAAATGAGCCAATTCTAACAAAATTAATAAATTCCGTTT
ACAAATGAGTTCATGCAAACGCCTTTTCCTCTTCAATACCTTTAAGTATACATTCCTTAA
AATCATGCATAGGTTGTTTAATAACCAATTGGTTAGATCTCTCCAGAAAAATTTGATTAA
GTACCTCAAGCTCCTCCTCCTCACATTTTTGCTAATTCTTAATTGCTAAATAATTAAGAC
ATTTCAAAGATATCTAAAAATCAATTCTAGCTAAAATAATAAATGTAAGGCTATAATAAG
CCTTCTCACTCCAAATAGCTATCATGCTAATAATTAGGATAATACGATTAATAGAACTAA
GTATAACAACTTTAATAGAGTCAAATTTAATTTTCATAAGGAAATTAATACTAGCTTAAG
AATAACAAATTTAACTAAGATAGTAGCAATATTGTTAACCAAAGCTAATAAGGTAACAGC
ATCTGCAACAACAGCATGACTTTCCATAATAATTCATAGAATAAAAATTAAATTAATAGC
TCTAACGTTAACAGCTAACCTATTAAAGGAAAAAAGAAATTAGAAATAAAAGAGGAGGAT
ATAAGCTATGATATTGATTTAGATAAGTTAGGTGAAGATAAGCGTACTACCGTTTGCATT
AAAAATATCCCAAACAAATATTAGCTTAACTGTGTTTTACAAACAATAGAAAAAAATCAC
AAGGATAACTTTGACTTTTTCTACTTGCCTATTGATTTTAATAATAAGTGCAATGTTGGC
TATGCATTCATTAATTTTATCAAGCCAGAATACATTAAAGATTTTTATCTTGAGTTTAAT
GGCAAAAAATGGAAGAAGTTTAATTCAGACAAGATTTGCAGCTTAAAATATGCTACAATA
TAAGGTATTCCTTAATTACAAGAGCATTTCTAGAATTCGAGCGTTATGAACTAAAGAGAA
AAAAAGTTTAAACCAGTGTTTTTAAATGTCATAAGCAATATGATTGACAAACAAAAGCAA
CAATCTACATAAAATGATTGTAATAAATCAAATTTTAACGATGATAATAATGGCATTAAT
TAATAAATGGGTAAAAACAATTTTATGGAAGGAAGCACCAGTTAAAACTAGACTGAATAA
GCTTTCAACTATAACAATAACAAGTAAAACAACTATTCCTATCAAAGCAATCACAGCCAA
CATAGCAACAGCAATAATAATACCAGCTAAGGAGGTTAAAATAGCACTAATTATCACAAA
AAAAATAACAGTAATAGTAATAACAACTATTTTAATAGATACCATAATTCTAATTAGAAG
AATTACAATAATAACAAACATGAATATGTTCAAAAGCAATGA


>TTHERM_00444880(protein)
MKNQSSNSSVDIEINSQCQKPSQQLLGPSIILKDHQEDRTKSNSSSQNSTFRKVHSTKGK
NEKSKRPSSVTQRPSSIPKFVSSFSNEAQKIGLNGNTRSQDDSYAVNSLISSMNNSYCIQ
QNAHDILAKSKLQNSYHQRGSSLQAIGQVNVFSTQYSSNLKGGSSQSLQNQVAQSQSLAN
SFVSVNQQAVGSSGDEKSGANVCQSFSAVISAQPVSELKIAGPEINNLQVSSQSQPLSDN
LVFKHASSLDLPPQSSLNVSSKLINQQVNAAHKYNNPKQLNEQQILKSQKHKQKNILENE
EDCDQKDKQEDEEQNEQNVCELQQAQGIEAFDVVANNKADSENQMSQVQIQGNNIFGINT
ELEKIDLNNSSSSKHTSNSITSRSHKNQSNISDDFLQDSKQESVNNNSMIVSSSNNSSRV
FKGSSNNSFILNQCTQKAAAQNPLNEFIQSKEEIKESISRSKYCAKPRDAHILQNARLPI
KPILQDESKNQILTLDDKLIAPPSIQVIQKPSQDLNESQLKGKQKLKQLMHRRGNTLSRN
DIEDLQFFEFQDSVFQKVSSEDEKVNSNQLENKQTSQENLSTNPLSFINPSQVYDFQNKN
NEEDNQNEQDYQQEDQDEDIEIKKQVELLNSDDSENEDKVRNIGKPSPHPPVGVYQQQIY
HPIPQQQSQQQMSFHPHLNPFVDIPSQSTPQIQQQNFDSFSKQSSTPNQQLEYISSKRIV
GPRPMSIDQQFSQFFATPNQQQIMNIPEKCGSPLQFTDYSQQQGQSPYILYESPAHQHIQ
SIYNQGMKQPTNNMNNIIQFNQMNTPSPPIQGNQQKNYQIFQQHTQMQQMMCQIPAQHSI
GIQQPQQNQQGNQQQQQQAGQIFNQNQISLGQQGQQQMMAMMKNQKQHLQIQPNSLFSSN
SSSTYHLQKQNCNLSQASTIDSADYINTFRSGSSYGVQDVQQDQVVKMIKQQSQSIQQQL
QVRSQCIQSQVQQQQSQQGPQLNQQLNFFPNHHLANQQEKGFFQQPNTNANQFLLEPFTS
QPQFNQYQMSQFQQNQQIPFTNEFMQTPFPLQYLQVYIPQNHAQVVQQPIGQISPEKFDQ
VPQAPPPHIFANSQLLNNQDISKISKNQFQLKQQMQGYNKPSHSKQLSCQQLGQYDQQNQ
VQQLQQSQIQFSQGNQYQLKNNKFNQDSSNIVNQSQQGNSICNNSMTFHNNSQNKNQINS
SNVNSQPIKGKKKLEIKEEDISYDIDLDKLGEDKRTTVCIKNIPNKYQLNCVLQTIEKNH
KDNFDFFYLPIDFNNKCNVGYAFINFIKPEYIKDFYLEFNGKKWKKFNSDKICSLKYATI
QGIPQLQEHFQNSSVMNQREKKFKPVFLNVISNMIDKQKQQSTQNDCNKSNFNDDNNGIN
QQMGKNNFMEGSTSQNQTEQAFNYNNNKQNNYSYQSNHSQHSNSNNNTSQGGQNSTNYHK
KNNSNSNNNYFNRYHNSNQKNYNNNKHEYVQKQ


>TTHERM_00444880(gene)
ATGAAGAATTAAAGCTCTAATAGTTCAGTAGATATAGAGATTAATTCACAGTGCTAAAAG
CCTTCTTAACAACTTTTAGGCCCAAGTATAATTTTGAAAGACCATCAGGAAGATAGAAGT
ATTTATTATACATCCACATTTCATTCATTTATCAAGCCTTGCCTTCAAAAATTTTATCCA
TTTTTAAAAATGATTCTTTTGCATTAATTAAAAGTTTTGTAAATAATTGAAAGATTAAAA
CAATTTTGCATAAAAAAACCATCATTTTGTGCATCTTACATAAGTTTTAAAATCAAATAT
TATAGCTAAAAGCAATTCTTCCTCATAGAACAGCACCTTCAGAAAGGTTCATTCAACTAA
AGGCAAAAATGAGAAAAGTAAAAGGCCTTCTAGTGTGACCCAAAGACCAAGTTCGATTCC
AAAATTTGTATCATCCTTTTCAAATGAAGCGCAAAAAATAGGTTTGAATGGAAATACAAG
AAGTTAAGATGATAGTTATGCAGTAAATAGTCTAATTAGTAGCATGAATAATAGTTATTG
CATTCAATAGAATGCTCATGACATTTTGGCTAAATCTAAACTCCAAAATTCTTATCATTA
ACGAGGAAGTTCATTGTAAGCAATAGGTTAAGTAAATGTATTTAGCACATAGTATTCAAG
CAATCTTAAAGGTGGATCTTCTCAATCTTTATAGAATTAAGTTGCTTAATCATAATCCCT
AGCTAACAGCTTTGTATCTGTTAATCAGCAAGCAGTAGGTTCATCTGGAGATGAAAAATC
TGGAGCAAATGTTTGCTAATCTTTCTCTGCCGTCATCTCAGCTCAGCCTGTATCTGAACT
TAAAATTGCAGGTCCTGAGATTAATAACCTTTAAGTATCATCACAAAGTTAGCCATTATC
TGATAATTTAGTATTTAAACACGCTTCGTCACTTGATCTCCCTCCTTAATCCTCTCTAAA
TGTCAGTTCAAAATTAATTAATCAATAAGTAAATGCCGCTCATAAGTATAATAATCCCAA
ATAGCTAAATGAGTAGTAAATTTTAAAGTCATAAAAGCACAAGTAAAAAAATATACTAGA
AAATGAAGAGGATTGTGATCAAAAAGATAAGTAAGAAGATGAAGAATAGAATGAGTAAAA
TGTATGCGAATTATAGCAAGCATAGGGTATTGAAGCCTTCGATGTAGTAGCTAACAACAA
AGCAGATTCTGAAAATTAGATGAGTTAAGTTTAAATATAAGGGAATAATATATTTGGAAT
AAATACTGAGTTAGAAAAAATAGATCTCAATAATAGCAGCTCATCTAAGCATACTTCTAA
CTCAATAACATCAAGGTCACATAAAAATTAGTCAAATATCTCTGATGATTTTTTGTAGGA
TTCAAAATAAGAAAGTGTAAACAACAACAGTATGATTGTTAGCAGTAGCAATAATAGCAG
CAGGGTTTTTAAAGGATCAAGCAACAATAGCTTTATCCTAAATTAATGTACTTAAAAAGC
AGCTGCATAAAATCCTTTAAACGAATTTATTCAATCCAAGGAAGAAATCAAAGAAAGCAT
AAGTAGATCTAAATATTGCGCAAAGCCTAGAGATGCTCATGTAAATTTTAAAAAATAGAT
TTCGACTTGAATTTGCTTTGTTGGTTATAAATGAAACCATTTTTATTTTGCAATTTGATT
TCTTTACAAATATATCTATCTCTCTATCAATCTAAGCTTTAAAAAATAGGAACAAATTTT
CTTTTTATTAAATTGATTAATTTAATTTTTTTGTTAAGTTCTAAATAAGATTTTTAAACA
AACATGCAAAACACTTATAGATAAATAGAATAGATATACATAAATACATATATTTATGCA
TGAATGCATACTTACCTATTATGATATTTTTTTTTAAATATTTATAAAATTTAAATAGAT
ACTTTAAAATGCAAGATTGCCTATCAAGCCTATTTTACAAGATGAATCTAAAAATCAAAT
TCTAACTCTAGATGACAAGTTAATTGCTCCTCCTTCAATTTAAGTAATATAAAAACCTAG
CCAAGATTTAAATGAATCACAGTTGAAAGGCAAACAAAAATTAAAATAACTTATGCATAG
AAGAGGAAATACTTTAAGTAGAAATGATATAGAAGATTTGTAGTTCTTTGAGTTTTAAGG
TAATTTTGAATTCATTTTGAATATTTTTGTTTATATTAATCTACTATTTTTAAAAGACTC
AGTCTTCCAAAAGGTTTCATCTGAAGATGAAAAAGTAAATTCTAACTAATTGGAAAACAA
GCAAACATCTCAGGAAAATTTAAGCACAAATCCTCTTTCTTTTATCAACCCTTCCTAGGT
CTATGACTTTTAGAATAAGAGTAATCCCCTATAATATGCATTCAATTATTTTTAAATTTT
TTTTCAACTCTTTCAATTTTTAGGATAGAAAAGAAGCAAATAAATAAGCTAAGAAATAAA
TTAATAAATAAACTTCAATGTTAATTTTTAAAATTTAAAAAGAAGATATCTTAATATTTT
TGTATTAATTATTTATTAAAGACAATGAAGAAGATAATCAAAACGAGCAAGACTACTAAC
AGGAAGATTAAGATGAAGATATTGAAATCAAAAAATAAGTAGAACTGCTAAACAGTGACG
ACTCTGAGAACGAAGATAAGGTAAGAAATATAGGTAAGCCCAGTCCTCATCCTCCTGTTG
GTGTTTACTAATAACAAATTTATCATCCGATTCCTTAGCAATAATCCCAGTAATAAATGA
GTTTTCATCCTCACTTAAATCCTTTTGTTGATATCCCAAGCTAGTCCACTCCATAGATTC
AATAACAAAATTTTGATTCTTTTAGCAAGCAATCTTCTACTCCTAATCAACAATTAGAGT
ATATTAGCTCAAAGAGAATTGTTGGCCCTAGACCAATGTCTATTGATTAGCAATTTTCTT
AATTCTTTGCTACTCCTAATTAGTAATAAATTATGAACATACCAGAAAAGTGTGGATCAC
CTTTATAATTTACTGATTACTCTCAATAGTAAGGGTAGTCTCCTTACATCTTATACGAAT
CACCAGCACATTAACACATTCAATCTATTTATAACTAAGGGATGAAGTAACCTACAAATA
ATATGAATAATATTATTTAATTTAATTAAATGAATACACCTTCTCCCCCAATCCAAGGCA
ACTAATAAAAGAACTATTAGATCTTTTAGCAACACACTTAGATGTAATAAATGATGTGCT
AAATTCCAGCATAACATAGTATTGGTATCTAGTAGCCTTAACAAAATTAATAGGGTAATC
AATAGCAATAGTAATAGGCTGGTTAGATATTTAATTAGAACTAAATAAGCTTGGGATAAT
AGGGCTAATAATAAATGATGGCTATGATGAAGAACTAAAAGCAGCACTTGTAAATATAGC
CTAACTCTTTGTTCTCTTCAAATTCAAGCTCTACATACCACTTGTAGAAATAAAATTGCA
ATCTATCTCAAGCATCAACAATAGACTCAGCAGATTATATCAACACTTTCAGATCAGGAT
CTTCTTATGGTGTTTAGGATGTCTAGTAAGATCAAGTAGTTAAGATGATTAAGCAATAGA
GTTAGTCGATATAGTAATAACTGCAAGTTAGAAGCTAATGTATTCAATCTCAAGTGCAGC
AACAATAAAGCTAGCAAGGACCTTAACTCAACTAGCAGCTAAACTTCTTCCCAAACCATC
ATCTCGCAAATTAATAAGAAAAAGGTTTCTTTTAATAACCTAATACAAACGCAAATTAAT
TTTTGCTTGAACCTTTTACTTCTTAACCTCAGTTTAATTAATATTAAATGAGCCAATTCT
AACAAAATTAATAAATTCCGTTTACAAATGAGTTCATGCAAACGCCTTTTCCTCTTCAAT
ACCTTTAAGTATACATTCCTTAAAATCATGCATAGGTTGTTTAATAACCAATTGGTTAGA
TCTCTCCAGAAAAATTTGATTAAGTACCTCAAGCTCCTCCTCCTCACATTTTTGCTAATT
CTTAATTGCTAAATAATTAAGACATTTCAAAGATATCTAAAAATCAATTCTAGCTAAAAT
AATAAATGTAAGGCTATAATAAGCCTTCTCACTCCAAATAGCTATCATGCTAATAATTAG
GATAATACGATTAATAGAACTAAGTATAACAACTTTAATAGAGTCAAATTTAATTTTCAT
AAGGAAATTAATACTAGCTTAAGAATAACAAATTTAACTAAGATAGTAGCAATATTGTTA
ACCAAAGCTAATAAGGTAACAGCATCTGCAACAACAGCATGACTTTCCATAATAATTCAT
AGAATAAAAATTAAATTAATAGCTCTAACGTTAACAGCTAACCTATTAAAGGAAAAAAGA
AATTAGAAATAAAAGAGGAGGATATAAGCTATGATATTGATTTAGATAAGTTAGGTGAAG
ATAAGCGTACTACCGTTTGCATTAAAAATATCCCAAACAAATATTAGCTTAACTGTGTTT
TACAAACAATAGAAAAAAATCACAAGGATAACTTTGACTTTTTCTACTTGCCTATTGATT
TTAATGTAAATTTATTCTTAACTTATAAAAAATTTGATATAAAAAAAATAAAAAATTAAT
TAGAATAAGTGCAATGTTGGCTATGCATTCATTAATTTTATCAAGCCAGAATACATTAAA
GATTTTTATCTTGAGTTTAATGGCAAAAAATGGAAGAAGTTTAATTCAGACAAGGTAAAA
ATATTGTTAATATTAGCTAATTTTATTAAATATTATAACAAATTAATAGATTTGCAGCTT
AAAATATGCTACAATATAAGGTATTCCTTAATTACAAGAGCATTTCTAGAATTCGAGCGT
TATGAACTAAAGAGTAAAAACTATTTATAAATCAGAGACTATCTTAATTAATTAATTTAT
TTTTTATTTTATAATAGGAAAAAAAGTTTAAACCAGTGTTTTTAAATGTCATAAGCAATA
TGATTGACAAACAAAAGCAACAATCTACATAAAATGATTGTAATAAATCAAATTTTAACG
ATGATAATAATGGCATTAATTAATAAATGGGTAAAAACAATTTTATGGAAGGAAGCACCA
GTTAAAACTAGACTGAATAAGCTTTCAACTATAACAATAACAAGTAAAACAACTATTCCT
ATCAAAGCAATCACAGCCAACATAGCAACAGCAATAATAATACCAGCTAAGGAGGTTAAA
ATAGCACTAATTATCACAAAAAAAATAACAGTAATAGTAATAACAACTATTTTAATAGAT
ACCATAATTCTAATTAGAAGAATTACAATAATAACAAACATGAATATGTTCAAAAGCAAT
GA