Identifiers and Description

Gene Model Identifier

TTHERM_01050580

Standard Name

RRM50 (RNA recognition motif-containing protein 50)

Aliases

PreTt27801 | 212.m00059

Description

RNA recognition motif-containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( TIGR01612 ) rhoptry protein
  • ( PF00515 ) tetratricopeptide repeat
  • ( PF07719 ) tetratricopeptide repeat
  • ( TIGR00864 ) polycystin cation channel protein
  • ( TIGR01563 ) phage head-tail adaptor, putative
  • ( TIGR00741 ) ribosomal subunit interface protein
  • ( PF00076 ) RNA recognition motif. (a.k.a. RRM,
  • ( TIGR01642 ) U2 snRNP auxilliary factor, large

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_01050580

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_01463.19.997093137033517e-262hypothetical protein (754 aa)
OxytrichaContig655.1.g200.000009999254677478949RNA recognition motif (a_k_a_
RRM, RBD, or RNP domain)

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_01050580(coding)
ATGCAACTAAAGTAGTCTTAAAAGGAGTAGATTAGAAATATCATCAATTCTAAGCTTTCC
AATAGCAAGAGAGGAGATGAAATATCCTCTTAAGTTGAAGATAAGGTCATAGATTTGATT
GAGAGATAGAATTTCTAAAGCAAAGATAGTCTCCAAGATAAATTGTAAGGAGAATTAAAG
GACATTTTAAAAGAAAACGCTCATCATATTAGTGAATCAGTTTCTAAGGTAATTTATAGC
AGCAACTATGATAATAGTGGCAACTCTGCCTAAAAAGATGACGATTATGAACAAAATTTA
TACAAGAACAAATTCTACTCAGACCATTCGGATAATTCTGATGATGAAGACGACGATGAT
GATGATAGAAGAGACAAGAGAAAGAGAAATTTTAAGAAAAGACTTAGCATTTAGCAATCT
GATATATAAAGCGATAACGAAAATAAAAGTTTGAGAAGCGACTCAGAAGGAAGAGAAGGA
AATAAAAGGGTTAGCAGAAAAGATAGCTATGCTAGTAATCATAGTGGGAAGAGAGATTAA
AATAAGGATGAAAAAGACTCTCATTATAATTCAAAATAAAACTATAACTAGAACAATGGA
AAATACCAAAACAATAAATACAACAATAATAATAGTAGGTTTAAAAATGATAAAAAAAAT
TTAAATAACAATGGAAACAATAAAAGATTAAGTAATGGACCAGCAGCTCCTTTACCAACT
TTCATGAGTATGAATAATGGAGGAATCATTCCAAATTTACTTACTAATAATCCTATGATG
AATTATCCCATGCCTAATAGTCTAAATTTAATGCAACCTTTTAGCGGTATATTCAATCCA
AGAGTAGGTCCTCCTGCACCTCCTACAGGAAAACCAGTCATCTCTTAAGCTGGTACTGGT
GCTCCTTCTATAACTCTATCAAAATCTAAAAATATTATTTATGTCTTTTACATACCACCT
AAATTGAATAATGTTACTAAAATTAGTTAGTATTTCACAAATAAATTTGGAGCTGTTTCA
GCTTATGACAAAATTGATGAAACCACTGCTTCAATAAAATTTGAAAAAGAAGAATCTGCT
TAAAAGGCAGTAGATTCAAAAGAAAAGCCATTCAGAATAGAATAAATTGTTGTAACTTTT
ACTAGAAGCCCAGCTCCTCCCAAACCAGCATTTGTGAACAAAGGCAATAATTAAAACAAT
AATTAAAATGGTGGAAAATCCACCTTGCATAGGAAGCCTAGCATCGATGGATCAGAACCT
GCCAAATAAAAATTCATAAAAAATGAAAACAACAACAGTACCACTTTTAACAACAACAAC
AACAATAATAATAATAGCAACATCAACAACTAAAAACCTAAGCTAGCAATTAATTTTGAG
CAGAAGAAAAAGCAAAAGCAATTTGATGAACAAAAAAGATTAATTTAACTAAAATTTGCA
GATAAGCTTAAAGTGATGATATTCATAAAAAAAAGGGAATAAAATCCTGAAAGCGAAATC
CGTTAAGAAGTTCAAAAATCTATTGATTAAATTAAATAAGTCAAAGATGTACTATCAAAA
GTATAAACTCAAGAAGATCTTTAATAAGTAGAATAGCATGAATTAATCGTTGAAAATCAA
TATGAATTTGCTCAAAAAATACGTTTCTTAGAAGGAAAAGACATGAGTTTGACTGAGTTA
CGTCCTAAGTTACTTGAATATGGAAAAGTAGAAACTTTGAAGCCTCACATTATGGAAAAA
GCTGTTGATATATGTTTTAGCGATTTTGAATCATCAGAAAAAGCATACTTTGGATTACAA
GGACAATATAATATAGAGTTCATTCATTAGCATATTGTTAAATTTTTAAAAAATCCTTTC
TAACCTTAGGATGAAGCTTAAGAAGAATAAGAAGAAGGAGGAAATTAGTTAGATCAAAAT
ATTGAATACTAAGAAGATGAATAATAGGGAGATTAAATTTAACAAGATTAAGCAAACGAA
AATTAAGAATAGTAATACCAATACGATGAAAATAATGAGGAATACTATGAAAACTAAGAA
TAAGCTTAGGAGGGAGAAGAATACTAAGAGAATATTGCTGAATAAGATGAATAGCAATAA
TAATACTAAGAATTATAAGATAATTAGCAAATTCAAGAGGAGGACCAATAAGTTGATGAT
GATCTTTGA


>TTHERM_01050580(protein)
MQLKQSQKEQIRNIINSKLSNSKRGDEISSQVEDKVIDLIERQNFQSKDSLQDKLQGELK
DILKENAHHISESVSKVIYSSNYDNSGNSAQKDDDYEQNLYKNKFYSDHSDNSDDEDDDD
DDRRDKRKRNFKKRLSIQQSDIQSDNENKSLRSDSEGREGNKRVSRKDSYASNHSGKRDQ
NKDEKDSHYNSKQNYNQNNGKYQNNKYNNNNSRFKNDKKNLNNNGNNKRLSNGPAAPLPT
FMSMNNGGIIPNLLTNNPMMNYPMPNSLNLMQPFSGIFNPRVGPPAPPTGKPVISQAGTG
APSITLSKSKNIIYVFYIPPKLNNVTKISQYFTNKFGAVSAYDKIDETTASIKFEKEESA
QKAVDSKEKPFRIEQIVVTFTRSPAPPKPAFVNKGNNQNNNQNGGKSTLHRKPSIDGSEP
AKQKFIKNENNNSTTFNNNNNNNNNSNINNQKPKLAINFEQKKKQKQFDEQKRLIQLKFA
DKLKVMIFIKKREQNPESEIRQEVQKSIDQIKQVKDVLSKVQTQEDLQQVEQHELIVENQ
YEFAQKIRFLEGKDMSLTELRPKLLEYGKVETLKPHIMEKAVDICFSDFESSEKAYFGLQ
GQYNIEFIHQHIVKFLKNPFQPQDEAQEEQEEGGNQLDQNIEYQEDEQQGDQIQQDQANE
NQEQQYQYDENNEEYYENQEQAQEGEEYQENIAEQDEQQQQYQELQDNQQIQEEDQQVDD
DL


>TTHERM_01050580(gene)
ATGCAACTAAAGTAGTCTTAAAAGGAGTAGATTAGAAATATCATCAATTCTAAGCTTTCC
AATAGCAAGTATAAAAAATTGTTTTCAAACATTCCTCTAAATTTAGTTTATTATTAAAAA
GGAGAGGAGATGAAATATCCTCTTAAGTTGAAGATAAGGTCATAGATTTGATTGAGAGAT
AGAATTTCTAAAGCAAAGATAGTCTCCAAGATAAATTGTAAGGAGAATTAAAGGACATTT
TAAAAGAAAGTAATAAGAAAAATTTGATTTTTTGAAAAATAAATTGTTTAGCTTGTGAAA
ATTTAATTTTTTACCTGTTTAACATTATTTTTTTATTTAATAATCTAATTAGACGCTCAT
CATATTAGTGAATCAGTTTCTAAGGTAATTTATAGCAGCAACTATGATAATAGTGGCAAC
TCTGCCTAAAAAGATGACGATTATGAACAAAATTTATACAAGAACAAATTCTACTCAGAG
TAATTAATTCTATTCATGATATCTTTTCAGTTTAAAGAAAATTAATTATATAAATTGAAT
ATTTAGATTTTATAAAATGTTTATCATTTTTTATTCTTAAAATTTCAAATATATCTTTTT
TGAAACTTAGCCATTCGGATAATTCTGATGATGAAGACGACGATGATGATGATAGAAGAG
ACAAGAGAAAGAGAAATTGTAAATAAATAAAAATATTTTTTTTTTAAGCTAACTTTTGAT
AATTTGCATAATTAGTTAAGAAAAGACTTAGCATTTAGCAATCTGATATATAAAGCGATA
ACGAAAATAAAAGTTTGAGAAGCGACTCAGAAGGAAGAGAAGGAAATAAAAGGGTTAGCA
GAAAAGATAGCTATGCTAGTAATCATAGTGGGAAGAGAGATTAAAATAAGGATGAAAAAG
ACTCTCATTATAATTCAAAATAAAACTATAACTAGAACAATGGAAAATACCAAAACAATA
AATACAACAATAATAATAGTAGGTTTAAAAATGATAAAAAAAATTTAAATAACAATGGAA
ACAATAAAAGATTAAGTAATGGACCAGCAGCTCCTTTACCAACTTTCATGAGTATGAATA
ATGGAGGAATCATTCCAAATTTACTTACTAATAATCCTATGATGAATTATCCCATGCCTA
ATAGTCTAAATTTAATGCAACCTTTTAGCGGTATATTCAATCCAAGAGTAGGTCCTCCTG
CACCTCCTACAGGAAAACCAGTCATCTCTTAAGCTGGTACTGGTGCTCCTTCTATAACTC
TATCAAAATCTAAAAATATTATTTATGTCTTTTACATACCACCTAAATTGAATAATGTTA
CTAAAATTAGTTAGTATTTCACAAATAAATTTGGAGCTGTTTCAGCTTATGACAAAATTG
ATGAAACCACTGCTTCAATAAAATTTGAAAAAGAAGAATCTGCTTAAAAGGCAGTAGATT
CAAAAGAAAAGCCATTCAGAATAGAATAAATTGTTGTAACTTTTACTAGAAGCCCAGCTC
CTCCCAAACCAGCATTTGTGAACAAAGGCAATAATTAAAACAATAATTAAAATGGTGGAA
AATCCACCTTGCATAGGAAGCCTAGCATCGATGGATCAGAACCTGCCAAATAAAAATTCA
TAAAAAATGAAAACAACAACAGTACCACTTTTAACAACAACAACAACAATAATAATAATA
GCAACATCAACAACTAAAAACCTAAGCTAGCAATTAATTTTGAGCAGAAGAAAAAGCAAA
AGCAATTTGATGAACAAAAAAGATTAATTTAACTAAAATTTGCAGATAAGCTTAAAGTGA
TGATATTCATAAAAAAAAGGGAATAAAATCCTGAAAGCGAAATCCGTTAAGAAGTTCAAA
AATCTATTGATTAAATTAAATAAGTCAAAGATGTACTATCAAAAGTATAAACTCAAGAAG
ATCTTTAATAAGTAGAATAGCATGAATTAATCGTTGAAAATCAATATGAATTTGCTCAAA
AAATACGTTTCTTAGAAGGAAAAGACATGAGTTTGACTGAGTTACGTCCTAAGTTACTTG
TAAAATATGAAAGATGTTATTTTTATTTAAACTTTAATTATTATTGTTTAGGAATATGGA
AAAGTAGAAACTTTGAAGCCTCACATTATGGAAAAAGCTGTTGATATATGTTTTAGCGAT
TTTGAATCATCAGAAAAAGTAAATAGATTAACAAATTTAGACCATTGATAAATAAATTAA
TTAATATTTAATAGATTTTTATTTTTTTGTTATTAATTTTTAGGCATACTTTGGATTACA
AGGACAATATAATATAGAGTTCATTCATTAGCATATTGTTAAATTTTTAAAAAATCCTTT
CTAACCTTAGGATGAAGCTTAAGAAGAATAAGAAGAAGGAGGAAATTAGTTAGATCAAAA
TATTGAATACTAAGAAGATGAATAATAGGGAGATTAAATTTAACAAGATTAAGCAAACGA
AAATTAAGAATAGTAATACCAATACGATGAAAATAATGAGGAATACTATGAAAACTAAGA
ATAAGCTTAGGAGGGAGAAGAATACTAAGAGAATATTGCTGAATAAGATGAATAGCAATA
ATAATACTAAGAATTATAAGATAATTAGCAAATTCAAGAGGAGGACCAATAAGTTGATGA
TGATCTTTGA