Identifiers and Description

Gene Model Identifier

TTHERM_00219250

Standard Name

RRM5 (RNA recognition motif-containing protein 5)

Aliases

PreTt22353 | 18.m00379 | 3701.m00138

Description

RNA recognition motif-containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00219250

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_06705.17.999776857243347e-93hypothetical protein (259 aa)
OxytrichaContig4371.0.g712.998800627344286e-26RNA recognition motif_ (a_k_a_
RRM, RBD, or RNP domain)
Stentor CoeruleusSteCoe_137937.781132241133797e-20
WormBaseWBGene000046980.00000000000040012475857291343locus:rsp-1 Probable splicin
g factor, arginine/serine-rich
1 status:Confirmed UniPro
t:Q23121 protein_id:CAA91395
.1
DictyBaseDDB_G02803930.0000000000010000211161514907DDB_G0280393 on chromosome: 3
position 3254509 to 3256772
SGDYHR086W0.00000030014504373857585NAM8 RNA binding protein, comp
onent of the U1 snRNP protein;
mutants are defective in meio
tic recombination and in forma
tion of viable spores, involve
d in the formation of DSBs thr
ough meiosis-specific splicing
of REC107 pre-mRNA; Nam8p reg
ulon embraces the meiotic pre-
mRNAs of REC107, HFM1, AMA1 SP
O22 and PCH2; the putative RNA
binding domains RRM2 and RRM3
are required for Nam8p meioti
c function

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00219250(coding)
ATGAGTAGTAGCAGTAGGAGATCAGGTTCAAATACAATTTTTGTTGGAAAATTATCTTCT
AGAGTTAGAGAAGAAGACCTCAGAGATGAGTTCAGAAGATACGGAAGAATTAGAGATATA
GATTTTAGAAGATAAAGGGGTTTTGCTTTTATTGAATATAGCAGCTCCTCTGATGCAAAA
TAAGCCGTAGAAGACATGGATGGATAGCGCTTCGAAGACACCCGTATAGTTGTTTAGTAC
AAAGAAAATAGAAGTGATCGCAACAGAAGAGGACCATCAACAGCTGATGTTTGTTACAAT
TGTGGAAGAAAAGGACATTGGGCTAATGAATGTAAGGAAGGAAATTGGAATAACAGATGT
TATAGATGCGGAAAAAGTGGACATTTAAAAAAAGAATGCTCTTTGAGCAGAACTCCTTCA
TCAAGAAGAGAATCTCCAAGACGTTCAAGAAGAAACAGAAGCTAGAGTGGAAGTAAAAGT
AAGAGTGTTAGTGACAGCAGAAGCAGAAGTAGATCTAAAGATAAAAATAGAGATAAAAAG
AGAAGATAATCTTACTCAAAATCTTCCTCTCGTTCTAAAAGTTCAAGATCAAGATCATCA
AGAAGAAGTTATTCAAGCTCCAAGTCAAGAGCATCTTCATCAAGATCAAAGTCCAGATCA
TCAAATTCTTCCAAAGAAAATAACAAGAATCAAAGAAAGAGCATGAGTGAGTCAAGAAGT
AGAAGAAATTCTAACAATAATAGAAGCTCTTCTCCTCCTAAATAAAACTGA


>TTHERM_00219250(protein)
MSSSSRRSGSNTIFVGKLSSRVREEDLRDEFRRYGRIRDIDFRRQRGFAFIEYSSSSDAK
QAVEDMDGQRFEDTRIVVQYKENRSDRNRRGPSTADVCYNCGRKGHWANECKEGNWNNRC
YRCGKSGHLKKECSLSRTPSSRRESPRRSRRNRSQSGSKSKSVSDSRSRSRSKDKNRDKK
RRQSYSKSSSRSKSSRSRSSRRSYSSSKSRASSSRSKSRSSNSSKENNKNQRKSMSESRS
RRNSNNNRSSSPPKQN


>TTHERM_00219250(gene)
ATGAGTAGTAGCAGTAGGAGATCAGGTTCAAATACAATTTTTGTTGGAAAATTATCTTCT
AGAGTTAGAGAAGAAGACCTCAGAGATGAGTTCAGAAGATACGGAAGAATTAGAGATATA
GATTTTAGAAGATAAAGGGGTTTTGCTTTTATTGAATATAGCAGCTCCTCTGATGCAAAA
TAAGCCGTAGAAGACATGGATGGATAGCGCTTCGAAGACACCCGTATAGTTGTTTAGTAC
AAAGGTAAATAAGCAAAATTTGTTTTTTAAAAACTAATTTTATAACATTTTAGGATAAAA
TAAATATAAAAAGCTAAAATCTATTTACAAATAATAAAATTTTATAATTAAATAAATATT
TTAAAATTTATAATTAGAAAATAGAAGTGATCGCAACAGAAGAGGACCATCAACAGCTGA
TGTTTGTTACAATTGTGGAAGAAAAGGACATTGGTAAATCATATTTTACATTTATTTTAA
ATTATAAAAAAAGCAAACGAGGAGTATTTAAAAATATCAAAAAGTATTATTACTGCACGT
ATCATTCATTCATTTTAATGATAAATCGAACATTTAATTTTAGTAAAAAAATCAAAAAAC
TCCTCTTTAAGCATCATCATTTAGAACTTAAATATAATAATACCTAATATTTTTATAGTA
TCATCTAATATAAGCATAAATAATGGAAATAAATATTGATAAACATACATGATTTTACTA
AAATAACAAATTTTATATTTTAACTTTCCCCAAATATACTAACTAAGATCTAAAAAACAA
TTTAATTTTTCATTTATAATCTTGGATTAGTTTAGATGGTGGAATTAGTTTTTGTATGGA
GTAGCAAAAATTGAGTTTTACCATGAAGAATTTTTCAGATTTAAAATCACAATAATGTCA
AAGTAAAGGCTAGAAGATTAATTCAATCATTAGAAGAGCTTCTTGCATTCATTCCTTTCT
TCTTTTGTTGATTTATTTGAGAACTAAATTTACAAAATCCAAAAAATTTGCTTGACAATT
TTTAAATTTGGAAGAAGCAAAAGATAGATAAATAAATAAATGTTGGTTGTTTATTATATG
AATAAATAAATAATTAATTAATTTACTCGATAAAAAACTTCCAGAAGAATGAGAAGAATG
CATCGAAGAAAATGAACGAAAACGAAGATATGAAAAGTAGTAAAAAGATAAGATATTATT
AATTTTTAATTGTTTCGAATACTGAAAAATATAAATTAAATAAAGAATTGATGATTAAAT
ATGGTGATTGATGAAAATCAAGAAGAATCAATGAAGTCGAAGAAGAAGAAATTTAAATAC
CACAATTCGAGTTCTACAATAATTTAAAGCCATATATATTGTTTGTTGATTCAAAAAAGA
AGAATATATCAGTTGAATTTGGAATTTCTTACTTTTGTTTTTCTTATGTTTCTCAAACAA
GATTTTTATTAAACCAAGTATTAAGTTTAAGTGATTAAGTTTGAAGAGGGTGAGGAAGAT
ATTGATGATTATTTTGATGATAGTTTTGATGATGATGATAGTAATGATGATGAATCAAAA
GATGAAGACGATTAAAATTAATGTAATTTAAGATTGTCCATCAAAAGCAAAAATAAATAA
ATAAATAAAATTAATTACAAATAAATGGTTTTAAAATATTTTATAAGAGCAAACAAAGAA
AATAAAAATGAGCTATTAGATTTAATTTTATATAAAAATCAAAGCTAATTAGATATAAAT
TAAGTATTCCTCAATATAAATCATTAAAATATCATTAAATATTAAATAAAATTTTAATAA
TATATAACAATTAGGGCTAATGAATGTAAGGAAGGAAATTGGAAGTAATTTATTTATTTA
TTATTTTATTTTAATCATATTTAATTAAATTTATTTAAATTTAATAGTAACAGATGTTAT
AGATGCGGAAAAAGTGGACATTTAAAAAAAGAATGCTCTTTGAGCAGAACTCCTTCATCA
AGAAGAGAATCTCCAAGACGTTCAAGAAGAAACAGAAGCTAGAGTGGAAGTAAAAGTAAG
AGTGTTAGTGACAGCAGAAGCAGAAGTAGATCTAAAGATAAAAATAGAGATAAAAAGAGA
AGATAATCTTACTCAAAATCTTCCTCTCGTTCTAAAAGTTCAAGATCAAGATCATCAAGA
AGAAGTTATTCAAGCTCCAAGTCAAGAGCATCTTCATCAAGATCAAAGTATATTTAAAAA
ATTATATTCTTTTAGTAATTTATTTTTTTTATCAAAATAGGTCCAGATCATCAAATTCTT
CCAAAGAAAATAACAAGAATCAAAGAAAGAGCATGAGTGAGTCAAGAAGTAGAAGAAATT
CTAACAATAATAGAAGCTCTTCTCCTCCTAAATAAAACTGA