Identifiers and Description

Gene Model Identifier

TTHERM_00852930

Standard Name

RRM49 (RNA recognition motif-containing protein 49)

Aliases

PreTt01192 | 150.m00084 | 3834.m00359

Description

RNA recognition motif-containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF08243 ) SPT2 chromatin protein
  • ( PF00076 ) RNA recognition motif. (a.k.a. RRM,

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00852930

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00852930(coding)
ATGAAAGAAGAGGTAAAAATCAAAGAGGAAATAACAGATTTAGAAGTAGAGGTGGCAATG
ACGATAGAAGAAGACACCAAAATAGAAACAGAAGAGATAATTAGAGGGACTCGAACAACT
GGAATGACAACAAGTTCGATAGAAGACAAAGAAAAGGATCATTCAACAATAAAGAAGAAG
AAGAAAGAACAACTGGCAAGTTTGTAGTTATTGAAAATTTGCACTATTCAGTAACTGAAG
AAGAATTATAAGAACATGTTAGTAAATATGGTGAAGTAATTTAATGCAAAATCTTTTGGG
ATGAAAATGGAAGAAGCAAAGAAAAGGCAATTGTTTAATTTGAAAACGAAGAAGATGCTA
AAGAAGCTATTGAAGATTTAGAAGGTTCTTCTATTGAAGAGTAAACTTTAAGTGCTCATT
ATGCATCAAACGACGATGTTCATTATATCAAAAAAACTAAAAAAATTTAGAAGCAAAGCA
AAGCTTTCAACAGAAGAAGATGATGATTTGAAACATAAAAAACTATCTAAAATAAAATTG
ATTGAGTATAAAAAATATTAATTGTTTATATTTACTTCATTTTATTAATGTTTAAAAAAA
CCATTTTTGTTTTTAAATTAGTAAACTAATTAATTTACTTATCAATTCAATTAACAATTC
CTTTAATATTTTAATCAAATATCTAATTCCAAAGCTTTATATTAGAGTTGA


>TTHERM_00852930(protein)
MKEEVKIKEEITDLEVEVAMTIEEDTKIETEEIIRGTRTTGMTTSSIEDKEKDHSTIKKK
KKEQLASLQLLKICTIQQLKKNYKNMLVNMVKQFNAKSFGMKMEEAKKRQLFNLKTKKML
KKLLKIQKVLLLKSKLQVLIMHQTTMFIISKKLKKFRSKAKLSTEEDDDLKHKKLSKIKL
IEYKKYQLFIFTSFYQCLKKPFLFLNQQTNQFTYQFNQQFLQYFNQISNSKALYQS


>TTHERM_00852930(gene)
ATGAAAGAAGAGGTAAAAATCAAAGAGGAAATAACAGATTTAGAAGTAGAGGTGGCAATG
ACGATAGAAGAAGACACCAAAATAGAAACAGAAGAGATAATTAGGCAATTTTCCTAAAAA
TCATTTGATTAACTCATTCATAATAAGAATTATATAAAAAATAGAGGGACTCGAACAACT
GGAATGACAACAAGTTCGATGTAATAAATTAGTTTTGATGTCTTTTCAATAATATTTTCC
ACTCTTTTTATTAATAATTTATTTATCAAAATAATATCAACTAATGAAATTCTAATATCA
ATTTATCAGAGAAGACAAAGAAAAGGATCATTCAACAATAAAGAAGAAGAAGAAAGAACA
ACTGGCAAGTTTGTAGTTATTGAAAATTTGCACTATTCAGTAACTGAAGAAGAATTATAA
GTATTTTTTAACTATTTTTAGTATTTTTTTGGTAGTTTATCATATTGATTAAAAAGCAAA
CTTTAAACAGAAAAGTAAATAAGTATTTAGTTAAAATTTTAATTTATTATCTAATTAGGA
ACATGTTAGTAAATATGGTGAAGTAATTTAATGCAAAATCTTTTGGGATGAAAATGGAAG
AAGCAAAGTAAAACATATTATTTGCACATTTTTTTATTTGTTACGAAATTAATATCTTCG
TATCTTAGAAGTTAACAAACGAATAATAAATTTCTTTATTTCGCGGTTTAGGAAAAGGCA
ATTGTTTAATTTGAAAACGAAGAAGATGCTAAAGAAGCTATTGAAGATTTAGAAGGTTTT
TTAATTAGTCTAATATTTATTAAAATAAATTTGTAATAAACTATTTACTAAAGGTTCTTC
TATTGAAGAGTAAACTTTAAGTGCTCATTATGCATCAAACGACGATGTTCATTATATCAA
AAAAACTAAAAAAATTTAGAAGCAAAGCAAGTAATTTTCGATATTTGTGTTTAAAAATCT
CACATAATTTTGTTAATTTAAAGAGCTTTCAACAGAAGAAGATGATGATTTGAAACATAA
AAAACTATCTAAAATAAAATTGATTGAGTATAAAAAATATTAATTGTTTATATTTACTTC
ATTTTATTAATGTTTAAAAAAACCATTTTTGTTTTTAAATTAGTAAACTAATTAATTTAC
TTATCAATTCAATTAACAATTCCTTTAATATTTTAATCAAATATCTAATTCCAAAGCTTT
ATATTAGAGTTGA