Identifiers and Description

Gene Model Identifier

TTHERM_00756450

Standard Name

RRM48 (RNA recognition motif-containing protein 48)

Aliases

PreTt18308 | 123.m00127 | 3742.m00057

Description

RNA recognition motif-containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF05172 ) MPPN (rrm-like) domain
  • ( TIGR00166 ) ribosomal protein S6
  • ( PF07491 ) Protein phosphatase inhibitor
  • ( TIGR01622 ) splicing factor, CC1-like family
  • ( PF00076 ) RNA recognition motif. (a.k.a. RRM,
  • ( TIGR01628 ) polyadenylate binding protein, human types

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 13.7%

TetraMine Data

TTHERM_00756450

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_15406.19.997093137033517e-262RNA binding protein (445 aa)
OxytrichaContig7157.0.g239.999888128184441e-42RNA recognition motif_ (a_k_a_
RRM, RBD, or RNP domain)
DictyBaseDDB_G02899412.9998215087698487e-30DDB_G0289941 on chromosome: 5
position 3478416 to 3479861
SGDYOL041C7.003307964816097e-28NOP12 Nucleolar protein involv
ed in pre-25S rRNA processing
and biogenesis of large 60S ri
bosomal subunit; contains an R
NA recognition motif (RRM); bi
nds to Ebp2; similar to Nop13p
and Nsr1p
WormBaseWBGene000086881.999790113608142e-24status:Confirmed UniProt:Q95
QL3 protein_id:CAC70081.1
Stentor CoeruleusSteCoe_261822.6102790696677047e-23

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00756450(coding)
ATGAGCGGAACTTTAGGATATTTATTATAGCAAAGTGCTTAAAATCAAGGAAAAAAATCC
AATGAAAAGACAAACAGCAAGGCTGTTTCAGAAGTTGCCGATTTATTTTCTAAGGAAAAG
ACTGTTTTAGCTGAACCAGTTATTGTAGAAGCTATCATTAATCCTGAAAATGAAGAAAAT
GAGGAAAATAATCCTTTCATTGATGAAAATATGACTGCAAAATAGAAAAAAGAAAAGGAT
GATAGAACTGTTTTTGTTGGTAACATCTCCTTAGAAGCTACTGGTAGTTAAATTGCTAAA
GAGTTTAAACAATACGGAAAAATTGAAAAGATTTGGATTAGATCAGTCCCAGTTGAAAAC
TCAAAAATGCCTAAAAGAGCTAGTGTTATCCTCAAAAAGTTTAAGGATGGTGCTGATAGA
AAGAATGCTTACATTCTATTTTCTACATAAGAAGAAGCTGAAAAGTCACTTGAAGCTAAT
GGAAAGGTATTTTTGGAAAAGCACTTGAGAGTAGATAAAGCAAATGAAAAAATATTGGAT
TACACCAGAACTATATTTGTTGGTAACTTGCACTTTAAGATTTCTGAAGAATAGCTTAGA
CATCATTTTGAAAGCTGTGGTGATATCTTGAACGTAAGAGTTATCAGAGATCCTAAAACT
CATGAAGGAAAAGGATTTGGTTATGTTTTCTTTAAGGAAAAGACTGGATTCTAAAATGCT
TTAGAAAAAAATGGAACTAAACTCCTTGAAAGAGAAATTAGAGTTAAAAAAGCCGTCCCT
GCAGAGAGACTTGAAAAGAAAAAAGTTAGAAAAGCTGAAAAGGCTAACATTATAAATAAG
GAACATGCTATTTAAAGATTAAAAAGTAAATTGAAAGGTAAAGCCGTTGTTCATGACCAA
GATGATTCCGATGATGAGTAAGAATAGCCTAAGGTTAAAAAAGTAAAGAAGGGTATTCAA
AAAAACGACACTATTCCTACAAAGAACTTTGAAAAGAATATGAAGACAACTAACTTTAAA
GAAAACGAAAATGAAATTTTCGACTTTAAAAATGAAATGTCTATTGCTCCTAGAGTCTTG
AGAAAGAAAATTAAAAAACTTAGCAAAAAGGGAATTGAATCAACTGAAGCTTTTTCAAAG
GTTTAGCAACTTAAGAAAAATAAAAAGATTAGCAACGATAAAAATATCTTTAATTCTAAA
TTCACTCTTTAAGCTAGAAAAGATAAAAGATTCAAAAAAGCCATGCAAAATAAGAAAAAA
GGTAAATTAGAAGTAAAGAAAGAAGATAGAAAAGACAAAAAGAAAAAAACAACAACAGCA
GCAGCCTCCACAGCTAAGAAATAAACTAATTAATGA


>TTHERM_00756450(protein)
MSGTLGYLLQQSAQNQGKKSNEKTNSKAVSEVADLFSKEKTVLAEPVIVEAIINPENEEN
EENNPFIDENMTAKQKKEKDDRTVFVGNISLEATGSQIAKEFKQYGKIEKIWIRSVPVEN
SKMPKRASVILKKFKDGADRKNAYILFSTQEEAEKSLEANGKVFLEKHLRVDKANEKILD
YTRTIFVGNLHFKISEEQLRHHFESCGDILNVRVIRDPKTHEGKGFGYVFFKEKTGFQNA
LEKNGTKLLEREIRVKKAVPAERLEKKKVRKAEKANIINKEHAIQRLKSKLKGKAVVHDQ
DDSDDEQEQPKVKKVKKGIQKNDTIPTKNFEKNMKTTNFKENENEIFDFKNEMSIAPRVL
RKKIKKLSKKGIESTEAFSKVQQLKKNKKISNDKNIFNSKFTLQARKDKRFKKAMQNKKK
GKLEVKKEDRKDKKKKTTTAAASTAKKQTNQ


>TTHERM_00756450(gene)
ATGAGCGGAACTTTAGGATATTTATTATAGCAAAGTGCTTAAAATCAAGGAAAAAAATCC
AATGAAAAGACAAACAGCAAGGCTGTTTCAGAAGTTGCCGATTTATTTTCTAAGGAAAAG
ACTGTTTTAGCTGAACCAGTTATTGTAGAAGCTATCATTAATCCTGAAAATGTAATTATT
TTGATACTCCTACAATTAAATAAAATCAATTTAAAAATCTAAATTATTCTGTTTTTTTAT
TTAGGAAGAAAATGAGGAAAATAATCCTTTCATTGATGAAAATATGACTGCAAAATAGAA
AAAAGAAAAGGATGATAGAACTGTTTTTGTTGGTAACATCTCCTTAGAAGCTACTGGTAG
TTAAATTGCTAAAGAGTTTAAACAATACGGAAAAGTAAAATAAAAATATGAAATTACAAT
ATATAAAAAAATTATTTTTTAATAGATTGAAAAGATTTGGATTAGATCAGTCCCAGTTGA
AAACTCAAAAATGCCTAAAAGAGCTAGTGTTATCCTCAAAAAGGTAATTTATAAAATAGC
AAATTAAAAATTATTTTAGGCGTATTCAACTTACTATTTACAAATTCTTAAAAGTTTAAG
GATGGTGCTGATAGAAAGAATGCTTACATTCTATTTTCTACATAAGAAGAAGCTGAAAAG
TCACTTGAAGCTAATGGAAAGGTATTTTTGGAAAAGCACTTGAGAGTAGATAAAGCAAAT
GAAAAAATAGTAAATAGATATAATACTTATTAATAGCAATATAAATAATATTATAATTAT
TAAAATACAAGTTGGATTACACCAGAACTATATTTGTTGGTAACTTGCACTTTAAGATTT
CTGAAGAATAGCTTAGACATCATTTTGAAAGCTGTGGTGATATCTTGAACGTAAGAGTTA
TCAGAGATCCTAAAACTCATGAAGGAAAAGGATTTGGTTATGTTTTCTTTAAGGAAAAGA
CTGGATTCTAAAATGCTTTAGAAAAAAATGGAACTAAACTCCTTGAAAGAGAAATTAGAG
TTAAAAAAGCCGTCCCTGCAGAGAGACTTGAAAAGAAAAAAGTTAGAAAAGCTGAAAAGG
CTAACATTATAAATAAGGAACATGCTATTTAAAGATTAAAAAGTAAATTGAAAGGTAAAG
CCGTTGTTCATGACCAAGATGATTCCGATGATGAGTAAGAATAGCCTAAGGTTAAAAAAG
TAAAGAAGGGTATTCAAAAAAACGACACTATTCCTACAAAGAACTTTGAAAAGAATATGA
AGACAACTAACTTTAAAGAAAACGAAAATGAAGTACTTACTAAATTTAATTTATTGCCAA
GTATAATACAAATAAAAAATTATAAAAAAATAGATTTTCGACTTTAAAAATGAAATGTCT
ATTGCTCCTAGAGTCTTGAGAAAGAAAATTAAAAAACTTAGCAAAAAGGTATTATAAATA
TTGAATTTTAAATTGAGAAAATTAATTTTTATTTATAATAAATTAGGGAATTGAATCAAC
TGAAGCTTTTTCAAAGGTTTAGCAACTTAAGAAAAATAAAAAGATTAGCAACGATAAAAA
TATCTTTAATTCTAAATTCACTCTTTAAGCTAGAAAAGTAATTAATTCGCTTAAATTTTT
ATTGATAAATATAATAATAATATTTTACTCGTAATTTAAAACAGGATAAAAGATTCAAAA
AAGCCATGCAAAATAAGAAAAAAGGTAAATTAGAAGTAAAGAAAGAAGATAGAAAAGACA
AAAAGAAAAAAACAACAACAGCAGCAGCCTCCACAGCTAAGAAATAAACTAATTAATGA