Identifiers and Description

Gene Model Identifier

TTHERM_00729040

Standard Name

RRM47 (RNA recognition motif-containing protein 47)

Aliases

PreTt07305 | 118.m00133 | 3739.m00055

Description

RNA recognition motif-containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF06357 ) Omega-atracotoxin
  • ( PF00076 ) RNA recognition motif. (a.k.a. RRM,

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00729040

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_17962.14.999773105566236e-81hypothetical protein (371 aa)
DictyBaseDDB_G02801630.000000007002490258088747DDB_G0280163 on chromosome: 3
position 3036716 to 3038045

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00729040(coding)
ATGGAATCCGTTATTCACATTACTAATTTAACTCCTGAAATCACTATTGATGAGATCAAG
GAAACATATGCTAAGAGTGGTACAATCAACAAGATAATTTTAGGTCGTAACGAAGCTCTT
GTTTTCTTCAGCGATGAAGATGAAGCCGAAAGTGCTTTAGTTTTTACTAACATTGGAGAA
ATTGAAGTTGAAGTTAACTAAGCCACCACTCTCACTTTGAATGATGTTGTATAAACTTTT
GACCACAATGAGACCTAAGAATCTACAAAAGAAGCTGGTTAATCTAATATCTCTTCTTCA
GTTAATGATTATGAAGTTATAACTCATAGCTAAATCAAATAAGAGACTGTTGTTGAATAG
CTAATAGCTCCTTAAGTTGAAGTAAGAAATGAAGTTGAAGCAAGAAATGAAGCTGAAACC
CTAAAAACTGAATAGGTTCGCTAAGTTGTAGTAGAAGAAGCTAAGGATTAAGTGAATAAA
ATTTAAGAACAAGCAGAAATTAAGGTTGAATAAGTATAAGAGAAATTAGCTTAATGGACT
GAAAATATTGAAAGATAACCTCTTTAAGTTCAACATGATTAATAAGCTGTAGTAGAAGAG
TATAAGCCTGTTGTTGTTGAATAACCTAAGACAGTTATAGTCGAACAACCTAAATAGGTC
TAAGTTGAAGAAATTAGACAAGTTGTCGTAGAAGAGCCAAAGAGAGAAGTTGTTGAATAA
CCTAGAAAAATTGTAGAAGAGCCTTAAATTACTAAAGTTGAAGAACCTAAGCACGTAGAA
CAAATCAGATAAGTCGAAGTTTAAGTCCCTGTTGCTCAATCCATTTAAGCAAAAGCTGAA
GAAAAAACTCAAGTATGCCCTCCTGAATCAAAGCCTTAAGTTTGCCCATACGCTGCTGGA
TCATGCTCTACATCTAGTACTAATTCTACTATAAATTCAGTTTAACTCCTCAATGCTTTA
AAAAATACTTCTCTTCCTGAAAGAAGCAAGCCTGTTGCATCAGATGTTTTCTAAAATGTC
TTCAATCCTAATTTCCTTTCTGGCTTAGTTGGCTTATTGATTGCTATCACTATATTCTCA
TAAATATTTTGA


>TTHERM_00729040(protein)
MESVIHITNLTPEITIDEIKETYAKSGTINKIILGRNEALVFFSDEDEAESALVFTNIGE
IEVEVNQATTLTLNDVVQTFDHNETQESTKEAGQSNISSSVNDYEVITHSQIKQETVVEQ
LIAPQVEVRNEVEARNEAETLKTEQVRQVVVEEAKDQVNKIQEQAEIKVEQVQEKLAQWT
ENIERQPLQVQHDQQAVVEEYKPVVVEQPKTVIVEQPKQVQVEEIRQVVVEEPKREVVEQ
PRKIVEEPQITKVEEPKHVEQIRQVEVQVPVAQSIQAKAEEKTQVCPPESKPQVCPYAAG
SCSTSSTNSTINSVQLLNALKNTSLPERSKPVASDVFQNVFNPNFLSGLVGLLIAITIFS
QIF


>TTHERM_00729040(gene)
AAAAAAAGCAAGAGGAGAAAACAATGCTGCAGGTAACATGAAAAAGAAATAAACCATTTA
CAAAAAATATACACTTAAAATTTTTACATTTTAAAAATAAATATATTTAATTAATTAAAA
ATATAAATTTTTATATCAAGCAAACTATCAATCAATATCTAAAAAAATACCCATCAAAAA
TTCAAACAAAATCTTTTAGTCAAAGCAATGGAATCCGTTATTCACATTACTAATTTAACT
CCTGAAATCACTATTGATGAGATCAAGGAAACATATGCTAAGAGTGGTACAATCAACAAG
ATAATTTTAGGTCGTAACGAAGCTCTTGTTTTCTTCAGCGATGAAGATGAAGCCGAAAGT
GCTTTAGTTTTTACTAACATTGGAGAAATTGAAGTTGAAGTTAACTAAGCCACCACTCTC
ACTTTGAATGATGTTGTATAAACTTGTAAGAAATAATTCATTAAATATTGCAAATAATTT
ATAGGAAGCAGAAATCTTAATATGATTTTACATTATGAAAGGATTTCTTTTTTACTTTTC
CTAATTAATAATTAAGATAAGCAAATTCGGATTAACAAATAATTATTTTTTCAAACAAAA
AAAAATAGTTGACCACAATGAGACCTAAGAATCTACAAAAGAAGCTGGTTAATCTAATAT
CTCTTCTTCAGTTAATGATTATGAAGTTATAACTCATAGCTAAATCAAATAAGAGACTGT
TGTTGAATAGCTAATAGCTCCTTAAGTTGAAGTAAGAAATGAAGTTGAAGCAAGAAATGA
AGCTGAAACCCTAAAAACTGAATAGGTTCGCTAAGTTGTAGTAGAAGAAGCTAAGGATTA
AGTGAATAAAATTTAAGAACAAGCAGAAATTAAGGTTGAATAAGTATAAGAGAAATTAGC
TTAATGGACTGAAAATATTGAAAGATAACCTCTTTAAGTTCAACATGATTAATAAGCTGT
AGTAGAAGAGTATAAGCCTGTTGTTGTTGAATAACCTAAGACAGTTATAGTCGAACAACC
TAAATAGGTCTAAGTTGAAGAAATTAGACAAGTTGTCGTAGAAGAGCCAAAGAGAGAAGT
TGTTGAATAACCTAGAAAAATTGTAGAAGAGCCTTAAATTACTAAAGTTGAAGAACCTAA
GCACGTAGAACAAATCAGATAAGTCGAAGTTTAAGTCCCTGTTGCTCAATCCATTTAAGC
AAAAGCTGAAGAAAAAACTCAAGTATGCCCTCCTGAATCAAAGCCTTAAGTTTGCCCATA
CGCTGCTGGATCATGCTCTACATCTAGTACTAATTCTACTATAAATTCAGTTTAACTCCT
CAATGCTTTAAAAAATACTTCTCTTCCTGAAAGAAGCAAGCCTGTTGCATCAGATGTTTT
CTAAAATGTCTTCAATCCTAATTTCCTTTCTGGCTTAGTTGGCTTATTGATTGCTATCAC
TATATTCTCATAAATATTTTGA