Identifiers and Description

Gene Model Identifier

TTHERM_00706330

Standard Name

RRM45 (RNA recognition motif-containing protein 45)

Aliases

PreTt26889 | 111.m00110 | 3744.m00030

Description

RNA recognition motif-containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF00076 ) RNA recognition motif. (a.k.a. RRM,

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00706330

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_17731.15.999393432078778e-90hypothetical protein (227 aa)

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:26688337: Kataoka K, Mochizuki K (2015) Phosphorylation of an HP1-like Protein Regulates Heterochromatin Body Assembly for DNA Elimination. Developmental cell 35(6):775-88

Sequences

>TTHERM_00706330(coding)
ATGAGTGAAGAAGTAGCTTTAGACGAATTTATTGAAGAAGACAAGAAAAACTAAAAAAAG
AGCGATAAAAATAATAATAACAAGGGCTTTAAGAGAAACTATAACAATAATAACAACAAT
AACAACAATAACAACAACAATAATGGCAATAAATTCATTAAAAGAACAAACAATAAGCCC
AATATTCATAATAATAATAACAACAACAATAATAGAAATAATAACTACCGCAACAATAAG
GAAGACAGATATGAAAAAAACGACAATAAAGATAGATATCATTAAGTTAAGAAGATTTCA
AAGCCTATATCAAAGGGAAGAAAAGATGACAATCATAATGATTCTCATTTCGGCCAAGGT
TCTAATTCACAAAATCCTCCAAGACAGTTAACAATAAATGCCGGTAAGAAAGTGACCATT
CCTAAGAAACTCTACACAGTAAAGGTTAAGAATCTTCCTTCTAGCATTAATTCTCATGAA
ATATATGAACTTGCCTCTGATAAAGAATAAGTTAAAGTTGACTCAATTACTACCACATTT
AATTGCAACTCTGACTCTAAATTAATAGAAGCTGAAATATCATATTACTAGCTTAGTGAT
GCACAAACCTTTGTTCAAAATTATAATGAAGCCACATTAGAAAATTAAGAATTGGAGGTT
TTATTAATTAACTGA


>TTHERM_00706330(protein)
MSEEVALDEFIEEDKKNQKKSDKNNNNKGFKRNYNNNNNNNNNNNNNNGNKFIKRTNNKP
NIHNNNNNNNNRNNNYRNNKEDRYEKNDNKDRYHQVKKISKPISKGRKDDNHNDSHFGQG
SNSQNPPRQLTINAGKKVTIPKKLYTVKVKNLPSSINSHEIYELASDKEQVKVDSITTTF
NCNSDSKLIEAEISYYQLSDAQTFVQNYNEATLENQELEVLLIN


>TTHERM_00706330(gene)
ATGAGTGAAGAAGTAGCTTTAGACGAATTTATTGAAGAAGACAAGAAAAACTAAAAAAAG
AGCGATAAAAATAATAATAACAAGGGCTTTAAGAGAAACTATAACAATAATAACAACAAT
AACAACAATAACAACAACAATAATGGCAATAAATTCATTAAAAGAACAAACAATAAGCCC
AATATTCATAATAATAATAACAACAACAATAATAGAAATAATAACTACCGCAACAATAAG
GAAGACAGATATGAAAAAAACGACAATAAAGATAGATATCATTAAGTTAAGAAGATTTCA
AAGCCTATATCAAAGGGAGTAATAGAATTAGAAAATTTCTCATATAAATCATTTCTTAAT
TCCAAAATTTGTTTCTGATATCATTTTATCTTTTGCATTAAACTTAAACTCAATTGTGTC
TAATCAATTTAATTTTTTTCTAATCAATATTAAAGAGAAAAGATGACAATCATAATGATT
CTCATTTCGGCCAAGGTTCTAATTCACAAAATCCTCCAAGACAGTTAACAATAAATGCCG
TAAAATATACTGATTTATATCTAATTTTACATTTTTGTCTAAAACATATTATTTACTGTA
TATTTTCTTATAATAAAAGGGTAAGAAAGTGACCATTCCTAAGAAACTCTACACAGTAAA
GGTTAAGAATCTTCCTTCTAGCATTAATTCTCATGAAATATATGTAACTAACCATTTAAT
TTATCAATAAAATTATAAAACAATAATTTTTATCCCAATAGGAACTTGCCTCTGATAAAG
AATAAGTTAAAGTTGACTCAATTACTACCACATTTAATTGCAACTCTGACTCTGTATTTA
TTTACTTATTATATTTATTGCCTACTAATAATTGGCCTCTTATTAATATTTTAGATTTTG
AAATTAAATTAATTACTTAAATGTTTTTTTTGTAATAGAAATTAATAGAAGCTGAAATAT
CATATTACTAGCTTAGTGATGCACAAACCTTTGTTCAAAATTATAATGAAGCCACATTAG
AAAATTAAGAATTGGAGGTTTTATTAATTAACTGA