Identifiers and Description

Gene Model Identifier

TTHERM_00685970

Standard Name

RRM44 (RNA recognition motif-containing protein 44)

Aliases

PreTt18211 | 104.m00143 | 3732.m00056

Description

RNA recognition motif-containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF03508 ) Gap junction alpha-1 protein (Cx43)
  • ( TIGR01659 ) sex-lethal family splicing factor
  • ( TIGR01649 ) hnRNP-L/PTB/hephaestus splicing factor family
  • ( PF00076 ) RNA recognition motif. (a.k.a. RRM,

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00685970

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_17382.19.997093137033517e-262polypyrimidine tract-binding p
rotein 1 (PTB) (1176 aa)
WormBaseWBGene000042070.0000000400154582995175locus:ptb-1 status:Confirmed
UniProt:Q18999 protein_id
:CAA85411.3
SGDYPL190C0.0004000184047659232NAB3 Single stranded RNA bindi
ng protein; acidic ribonucleop
rotein; required for terminati
on of non-poly(A) transcripts
and efficient splicing; intera
cts with Nrd1p

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00685970(coding)
ATGAAACAATAAGCAGTCTAGCAATTTAGTTCACCAAGTTATTTATCTTAGTAGCAGTAG
CATTAATAGTATTAGTAAAAATCGCTTAGCAAGAATTAGTAATTTCATCAAAGCTATTCG
GGCATGCCTCAAAATCATAGTCAGCAGAATTTTTAGAATTAGTATTCTAGCAGGAACGAA
GATTAATTTAGCGCGGCTTCATCTGCTGATAAATCTCTTGTATTTCAAGGAAACTGTTTA
AATTATTCTCAATAACAGCCTGTGTTTTAAAAGATCAATTAAAATTATCATTAAGAGCAC
ATGGCCTCAAATGATTAGTAAATGATAAATAATCCTCAGCAGTTGAATTTCGATCAAAAT
TCATACTTAATAAATAATGGTAGCAAGAGTAGCCATTAAGTACATCAACAATAATAAATG
GCATCTAGATTCTACGTACCACATAATCTCGGTTTTTACCAGAATAATTAACAACAAGAT
ATGAGCTAATAACAATCAAATTATTAATAATAGCAATAAATTTAAATAAACTAATAATTT
ATCTCTTCTCAGACATTATACACTTAAAATTTTTAGTTGAATGTGGGTTAGAATAATGAA
AAGGTCTCTTGCCACTAATTATAAGATTAAGGGATAGATTAAACAACGCACGTTAAACAT
TAGTACCAATAACAACAACAACAACAATAATAGCAATAACAACCTTTCTATCAAAACTCT
AAAAAATAATTTCAAACACACCACGAATAAAACGCAAGTTGCGAAAAATTTAACAAAGAA
AAAAGTTAATAATAATTAGAGGAATAAGGTAGTCCCTCTTCTGTTTTGTTAGTGATAGTA
TTTGAATTAAAAGATTTGCAAATAACAAATGACTAGCTACAATAAATATTCTCACCTTAT
GGATTTGTCAACAAAGTGCTAATATTTTAGAAGAGCACTGACTCTACTAAGGCATTTATT
GAAATGAACAGTGTAGAGTCAGCTAAAAAGGCTAAAGAAGCCCTCAACAGGGCCAAGATA
CCTCTTCTTCCTAACTAAAAATATAAATTCAAAGTTCACTACTCATAAACAACTGACTTA
AACCTTTGCAATTACAAAACTGAAGGCAAGGACTATCGCTTATCTTCAAACAAAATTACA
AATTCAACTACTTAAAACTTAATTTCTTCCAACTCGAATTCTAATTAAATCAATAACAAA
TTCTAATAATAAGCAATAAATCATAGCTCTCACGCCTCATGCAAAAATAAAATATAAGGA
AACTAAGAATAAGAATAGGAATAATTGAACCTTAAGCATCTCCCTTCTTCATCTTCTTCT
ATACCTTCTCCTAAAAACGCTTAGAGCTAATAATAGAATAGCTTCAGTAATATAAAAACT
CCTAACCAACAAAATAGGAATTAACAAACATCTCATAATAATCATGGCTTCAAAAATGTA
TCTAATTCGATAGGATAGACCATTGGAGCTATAACTTATGTTGAAAAAAGTTAATAGAAT
CCTCAAAACTAAGAGGAATTAATACAATAGTAATAGTATCAAGCTACAGTAGCTCCACCA
AATACTGTGAATCCACTCATATAAAATATAGTAATGTAGCCTCATTAAAATACTTAATTT
ACAGCAAATTCTTAGTTTTACAACCAAACAATTCAGCCATACTCGCAAAGTTTACAATCA
CTCACATCTACATCCACGCCTACTTCTTAGGGGAATATCACATTAGGAAGCAGCATAATC
CATAATAAATTATCTTCTTCCCAAACAAATATAGGATCGGTTAGAAATGAAAGTGCTACT
TACTTCTCCCCAATAACATTTTAAATATAAGGTGGAAGTGGCTTTAATTAGCAATTTTAA
GAAGAAAATGGAATCAAGGAAGAATTGGACTGTTTCAAATCTCCACTAGACCAAAAATAT
GAGATTAGTAATGCAGGAAATAGTAATGCTATCACTACTTCAAAAACTGTTAACATAGGA
AAGAATGATAGTAATTATCGTTAAGGCTCTTGTTCTATGCTTCCTACTAAGCTTGAAAGC
TTCGAAAGCTTTAATTAGATTTAAGATTAAGGAAATACTAGTATTTAGAATCTACCAGAA
TTCAATCTATAGTCAGCTTGCTAATAGAATATGAACAATCCATCATCAACTTAAAGCCAA
TCTCTTACAGATATTTCTCCTAGAAAAGGGAGCCTTGTTTTCTTGAATTCTGATATGGTT
GCGCATTAACAGAATAACTAAGATAATTATTATTCATAGATGAATTCATAATTTTCACAG
GCTTTATAATAAAAAGAGTTCAAGGTGCCTTCTTAGTCATTTATAGGTCCTTAGTCAATG
ATTGACATCACCTAAAACTCGAAATCAACTTGCTCAACTTCATCACCAAGTCCCTTTCAT
ACAGTAACTTCTCCATCTTATCCAAATTCATGTAAAACTCATCTTTACTAGCAAATTTCT
AGATTAGATAGTCTTTAATTAAATTAAGTTGATTTATCTAGCAATAATATTAGCTCATAA
TTTATTAACACCACTAATTCTTCCTAAGGTTTCATTAACAATCATTTAAGCAAATAATAT
TCTCATCCATCATAATAGCAATAAATTCAGCAACAGTCTTAACAATTTGCTTCATCTACG
CCTCTCATTTAAGAAAATAGCTTAGATTAGAGCTTTTCATCTGGAGTTGCATTATCGAAC
AATAATTTTTAAGATGAACCTAACAACATCTCTACCCTTAAATCAAAAAATTCTCTATCT
AACTAGCACAATGAGTAAAGCGAAAATTTGCCCCTTCAATCTTTATCTTATTTAGGTTAA
TAACAATAAACAGAAGAATCACCCGTTATTTACATAAAAAATATAAAAATAAATGAAGTT
ACTCCTGAAAATGTCTACAATATTTTCCGTAACTTTGGCTATGTTCACTCTATCCTCTTT
TTAAGGGAAAAGAAAACTGTATTAGTTTAATACGAAGAAGTAAGCTAGGCTAAAATGGCA
ATAAATTAGCTAAACAATATGAGCTTCTAAGGTGATGATCAAATGCGTATTTCGTATGCT
AAGCATAAAACAATAATTATTAGACAAAATTAAGGTTCAAAAACTTTGTAACAATTTCAA
TCATTTTAATAAAATGACAAAAATAATTAAAAATATTAATAATCAGATTATTTTGTAAAT
AAATATAATGATCCCAGGTCTAGAGCAGGAAGTTAAAATAATAAGAAAAACAACTTTTAT
AATCCTGTAAGCAAAACTGTTTATGTAACAAATATACCGATATAGCTAATCAAAAAAGAA
TAAGATTTCTTAAACATTTTTAAGCCTTACGGATCTGTAACTAAACACGATATAAGTAAA
TAAGACAAAAAAGTTACAGCTTTTGTGGAATTCGATACATTCTAGTCTGCCCTAAATGCT
ATCTGTTTCTTGCATAACTCTTAGCACTTTGGAAAATTAATTTAAATATTCTTTACTCGC
TCAATGATTAAACGATTTTCGACTGATTAGTGA


>TTHERM_00685970(protein)
MKQQAVQQFSSPSYLSQQQQHQQYQQKSLSKNQQFHQSYSGMPQNHSQQNFQNQYSSRNE
DQFSAASSADKSLVFQGNCLNYSQQQPVFQKINQNYHQEHMASNDQQMINNPQQLNFDQN
SYLINNGSKSSHQVHQQQQMASRFYVPHNLGFYQNNQQQDMSQQQSNYQQQQQIQINQQF
ISSQTLYTQNFQLNVGQNNEKVSCHQLQDQGIDQTTHVKHQYQQQQQQQQQQQQPFYQNS
KKQFQTHHEQNASCEKFNKEKSQQQLEEQGSPSSVLLVIVFELKDLQITNDQLQQIFSPY
GFVNKVLIFQKSTDSTKAFIEMNSVESAKKAKEALNRAKIPLLPNQKYKFKVHYSQTTDL
NLCNYKTEGKDYRLSSNKITNSTTQNLISSNSNSNQINNKFQQQAINHSSHASCKNKIQG
NQEQEQEQLNLKHLPSSSSSIPSPKNAQSQQQNSFSNIKTPNQQNRNQQTSHNNHGFKNV
SNSIGQTIGAITYVEKSQQNPQNQEELIQQQQYQATVAPPNTVNPLIQNIVMQPHQNTQF
TANSQFYNQTIQPYSQSLQSLTSTSTPTSQGNITLGSSIIHNKLSSSQTNIGSVRNESAT
YFSPITFQIQGGSGFNQQFQEENGIKEELDCFKSPLDQKYEISNAGNSNAITTSKTVNIG
KNDSNYRQGSCSMLPTKLESFESFNQIQDQGNTSIQNLPEFNLQSACQQNMNNPSSTQSQ
SLTDISPRKGSLVFLNSDMVAHQQNNQDNYYSQMNSQFSQALQQKEFKVPSQSFIGPQSM
IDITQNSKSTCSTSSPSPFHTVTSPSYPNSCKTHLYQQISRLDSLQLNQVDLSSNNISSQ
FINTTNSSQGFINNHLSKQYSHPSQQQQIQQQSQQFASSTPLIQENSLDQSFSSGVALSN
NNFQDEPNNISTLKSKNSLSNQHNEQSENLPLQSLSYLGQQQQTEESPVIYIKNIKINEV
TPENVYNIFRNFGYVHSILFLREKKTVLVQYEEVSQAKMAINQLNNMSFQGDDQMRISYA
KHKTIIIRQNQGSKTLQQFQSFQQNDKNNQKYQQSDYFVNKYNDPRSRAGSQNNKKNNFY
NPVSKTVYVTNIPIQLIKKEQDFLNIFKPYGSVTKHDISKQDKKVTAFVEFDTFQSALNA
ICFLHNSQHFGKLIQIFFTRSMIKRFSTDQ


>TTHERM_00685970(gene)
ATGAAACAATAAGCAGTCTAGCAATTTAGTTCACCAAGTTATTTATCTTAGTAGCAGTAG
CATTAATAGTATTAGTAAAAATCGCTTAGCAAGAATTAGTAATTTCATCAAAGCTATTCG
GGCATGCCTCAAAATCATAGTCAGCAGAATTTTTAGAATTAGTATTCTAGCAGGAACGAA
GATTAATTTAGCGCGGCTTCATCTGCTGATAAATCTCTTGTATTTCAAGGAAACTGTTTA
AATTATTCTCAATAACAGCCTGTGTTTTAAAAGATCAATTAAAATTATCATTAAGAGCAC
ATGGCCTCAAATGATTAGTAAATGATAAATAATCCTCAGCAGTTGAATTTCGATCAAAAT
TCATACTTAATAAATAATGGTAGCAAGAGTAGCCATTAAGTACATCAACAATAATAAATG
GCATCTAGATTCTACGTACCACATAATCTCGGTTTTTACCAGAATAATTAACAACAAGAT
ATGAGCTAATAACAATCAAATTATTAATAATAGCAATAAATTTAAATAAACTAATAATTT
ATCTCTTCTCAGACATTATACACTTAAAATTTTTAGTTGAATGTGGGTTAGAATAATGAA
AAGGTCTCTTGCCACTAATTATAAGATTAAGGGATAGATTAAACAACGCACGTTAAACAT
TAGTACCAATAACAACAACAACAACAATAATAGCAATAACAACCTTTCTATCAAAACTCT
AAAAAATAATTTCAAACACACCACGAATAAAACGCAAGTTGCGAAAAATTTAACAAAGAA
AAAAGTTAATAATAATTAGAGGAATAAGGTAGTCCCTCTTCTGTTTTGTTAGTGATAGTA
TTTGAATTAAAAGATTTGCAAATAACAAATGACTAGCTACAATAAATATTCTCACCTTAT
GGATTTGTCAACAAAGTGCTAATATTTTAGAAGAGCACTGACTCTACTAAGGCATTTATT
GAAATGAACAGTGTAGAGTCAGCTAAAAAGGCTAAAGAAGCCCTCAACAGGGCCAAGATA
CCTCTTCTTCCTAACTAAAAATATAAATTCAAAGTTCACTACTCATAAACAACTGACTTA
AACCTTTGCAATTACAAAACTGAAGGCAAGGACTATCGCTTATCTTCAAACAAAATTACA
AATTCAACTACTTAAAACTTAATTTCTTCCAACTCGAATTCTAATTAAATCAATAACAAA
TTCTAATAATAAGCAATAAATCATAGCTCTCACGCCTCATGCAAAAATAAAATATAAGGA
AACTAAGAATAAGAATAGGAATAATTGAACCTTAAGCATCTCCCTTCTTCATCTTCTTCT
ATACCTTCTCCTAAAAACGCTTAGAGCTAATAATAGAATAGCTTCAGTAATATAAAAACT
CCTAACCAACAAAATAGGAATTAACAAACATCTCATAATAATCATGGCTTCAAAAATGTA
TCTAATTCGATAGGATAGACCATTGGAGCTATAACTTATGTTGAAAAAAGTTAATAGAAT
CCTCAAAACTAAGAGGAATTAATACAATAGTAATAGTATCAAGCTACAGTAGCTCCACCA
AATACTGTGAATCCACTCATATAAAATATAGTAATGTAGCCTCATTAAAATACTTAATTT
ACAGCAAATTCTTAGTTTTACAACCAAACAATTCAGCCATACTCGCAAAGTTTACAATCA
CTCACATCTACATCCACGCCTACTTCTTAGGGGAATATCACATTAGGAAGCAGCATAATC
CATAATAAATTATCTTCTTCCCAAACAAATATAGGATCGGTTAGAAATGAAAGTGCTACT
TACTTCTCCCCAATAACATTTTAAATATAAGGTGGAAGTGGCTTTAATTAGCAATTTTAA
GAAGAAAATGGAATCAAGGAAGAATTGGACTGTTTCAAATCTCCACTAGACCAAAAATAT
GAGATTAGTAATGCAGGAAATAGTAATGCTATCACTACTTCAAAAACTGTTAACATAGGA
AAGAATGATAGTAATTATCGTTAAGGCTCTTGTTCTATGCTTCCTACTAAGCTTGAAAGC
TTCGAAAGCTTTAATTAGATTTAAGATTAAGGAAATACTAGTATTTAGAATCTACCAGAA
TTCAATCTATAGTCAGCTTGCTAATAGAATATGAACAATCCATCATCAACTTAAAGCCAA
TCTCTTACAGATATTTCTCCTAGAAAAGGGAGCCTTGTTTTCTTGAATTCTGATATGGTT
GCGCATTAACAGAATAACTAAGATAATTATTATTCATAGATGAATTCATAATTTTCACAG
GCTTTATAATAAAAAGAGTTCAAGGTGCCTTCTTAGTCATTTATAGGTCCTTAGTCAATG
ATTGACATCACCTAAAACTCGAAATCAACTTGCTCAACTTCATCACCAAGTCCCTTTCAT
ACAGTAACTTCTCCATCTTATCCAAATTCATGTAAAACTCATCTTTACTAGCAAATTTCT
AGATTAGATAGTCTTTAATTAAATTAAGTTGATTTATCTAGCAATAATATTAGCTCATAA
TTTATTAACACCACTAATTCTTCCTAAGGTTTCATTAACAATCATTTAAGCAAATAATAT
TCTCATCCATCATAATAGCAATAAATTCAGCAACAGTCTTAACAATTTGCTTCATCTACG
CCTCTCATTTAAGAAAATAGCTTAGATTAGAGCTTTTCATCTGGAGTTGCATTATCGAAC
AATAATTTTTAAGATGAACCTAACAACATCTCTACCCTTAAATCAAAAAATTCTCTATCT
AACTAGCACAATGAGTAAAGCGAAAATTTGCCCCTTCAATCTTTATCTTATTTAGGTTAA
TAACAATAAACAGAAGAATCACCCGTTATTTACATAAAAAATATAAAAATAAATGAAGTT
ACTCCTGAAAATGTCTACAATATTTTCCGTAACTTTGGCTATGTTCACTCTATCCTCTTT
TTAAGGGAAAAGAAAACTGTATTAGTTTAATACGAAGAAGTAAGCTAGGCTAAAATGGCA
ATAAATTAGCTAAACAATATGAGCTTCTAAGGTGATGATCAAATGCGTATTTCGTATGCT
AAGCATAAAACAATAATTATTAGACAAAATTAAGGTTCAAAAACTTTGTAACAATTTCAA
TCATTTTAATAAAATGACAAAAATAATTAAAAATATTAATAATCAGATTATTTTGTAAAT
AAATATAATGATCCCAGGTCTAGAGCAGGAAGTTAAAATAATAAGAAAAACAACTTTTAT
AATCCTGTAAGCAAAACTGTTTATGTAACAAATATACCGATATAGCTAATCAAAAAAGAA
TAAGATTTCTTAAACATTTTTAAGCCTTACGGATCTGTAACTAAACACGATATAAGTAAA
TAAGACAAAAAAGTTACAGCTTTTGTGGAATTCGATACATTCTAGTCTGCCCTAAATGCT
ATCTGTTTCTTGCATAACTCTTAGCACTTTGGAAAATTAATTTAAATATTCTTTACTCGC
TCAATGATTAAACGATTTTCGACTGATTAGTGA