Identifiers and Description

Gene Model Identifier

TTHERM_00683070

Standard Name

RRM43 (RNA recognition motif-containing protein 43)

Aliases

PreTt16144 | 103.m00135 | 3734.m00047

Description

RNA recognition motif-containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF07813 ) LTXXQ motif
  • ( TIGR01622 ) splicing factor, CC1-like family
  • ( PF06513 ) Repeat of unknown function (DUF1103)
  • ( PF00076 ) RNA recognition motif. (a.k.a. RRM,

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 11.1%

TetraMine Data

TTHERM_00683070

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_17797.19.997093137033517e-262RNA binding domain-containing
protein (566 aa)
OxytrichaContig18138.0.g757.001141985045207e-89RNA recognition motif_ (a_k_a_
RRM, RBD, or RNP domain)
DictyBaseDDB_G02895471.999981404597394e-31DDB_G0289547 on chromosome: 5
position 2930859 to 2932103
WormBaseWBGene000220251.000382677035467e-28status:Confirmed UniProt:Q9B
L57 protein_id:CCD71919.1
SGDYNL286W1.000116773704384e-19CUS2 Protein that binds to U2
snRNA and Prp11p, may be invol
ved in U2 snRNA folding; conta
ins two RNA recognition motifs
(RRMs)

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00683070(coding)
ATGGAGGAATTTATTTGGTATTATGCAGATAGTTAAGCTCTGTAAGAGAGAACACCTATA
GGACCTGTTAGCATTAGAGATTTAGATGTTTTGTATAGGACTTCAGCAATAAATTCTGCA
ACTTATGTTTGGAAAGAAGGTATGCCTGAATGGGTTTAACTTTTTAAAGTATAGGAATTG
AAGGAGGCTATTCTAGACGAGCAATAAGATATTAAGGTAATATAAGAACTTTATGAAAAG
TAGTAGCAGGAACTAGCTCTAGCTAATTAAAAGGGTAAAAAGTAATAGAAAATACAAGAT
AAACTTGACAAAAAATAAGCTTAGATTGATCAAAAGTTGCTTGAGGAAGCTAAATATAAT
TAATCAATGAATAGTGGCAAGGAGGAAGATATAAGTCAAGATTAGGTAAAATAAAACTTG
GAATTGTTATAGCAAATAGATGAAGAAGAAGTGTTAGATGAAGATGAAGAAGAAGAAAGG
GAGTATTTAAAGCTGTTATAAGAAAATCCAGAAGAAGCGATTTAAAGAATGGCCAATAAC
ACTTTAAACAGCTATTTTTACTATTCTGAAGATGATAAAAAGTGGAATATTTGTAGAGAA
GATGAAAATAATGAGAGAGTTTGGATCTAATAAGATGAAGAACCTAAAGAAGAAATGGAT
AAAATGAGAAATGAATTGATAGAAAAGCTTAGAAAATAATTTATAGGTGAAGAAAACAAA
GATATTGAGACATTGAAAAGCAATTTGAAAGATCAGCTATAAATGTAAAATGATATTGAA
GATAATAACGCTGATCCTAAAGATAAAGAAATTATGAAAGGTATGACAGCAGAGCAAATT
AAAAAGATAAAACGTAACAAAAAGAAAGCCAAAAGATAAGCTGAAAAAAAGAAATAGAAA
TGGTATTAATCTAGGGTTAATACATATATATATGTAAAGGGATTGCCTCTTTCTATTACA
GAAGAAAAACTCGATGAATTCTTTTCCAGAGCAGGAGTAATTAGAAAGGACCCAATCACC
AATAAAAAAAAGATCAAAATTTACTCGGATGAAAACGGTCTCCCTAAAGGTGATGCAGTT
ATCAGCTTTTAGATGATGGAATCTGTAGAAATTGCAATTACTATGCTTGATGAGAGAGAA
ATAGAACCAGGCCATATTATTAGGGTCGAAAGAGCTAATTTTGAATAGCATGGAGATACT
TATAAGAAAAGAGAAGGTGTTGTTATTAACAAAGAAAAAGCTTTGGATAAAATTTAACTT
GCCTAAATGAAAGCTGCTCAAAGATAGGCTCTGGGTTGGGAAGATGAAGACCAAATTGAC
ACAGGACTTAAAATTGTCATATTAAAAAATGTATTTACTCTTAAGGATATAGAAGAAGAT
CCAAATTTCTTGGAAGAACTCAGAGAAGAAATGGCTAAAGAGATAGAGTCAACTTGTGGA
CCAATTTAGAGATTAAAAATATTTGAAGAAAATCCAGAAGGAGTTATTGAAATTAAATTT
AAAAATTCTGCTGATGCCAAGGTTTGCATTCAAAAAATGGATGGTAGATATTTTGATGAG
AGAGAACTTGAGTGCTTTTTCTGGGATGGTAAGGTAGATTACAAAAGGTCTTAAAAACAA
ATGGAAGATGACGAATAAAGACTTGAAGAATTTGGTAAATGGATAGAAGGAGGTGATAAT
AATAATTCAGAAAATGGTTAAAAATAAATTAGTTGA


>TTHERM_00683070(protein)
MEEFIWYYADSQALQERTPIGPVSIRDLDVLYRTSAINSATYVWKEGMPEWVQLFKVQEL
KEAILDEQQDIKVIQELYEKQQQELALANQKGKKQQKIQDKLDKKQAQIDQKLLEEAKYN
QSMNSGKEEDISQDQVKQNLELLQQIDEEEVLDEDEEEEREYLKLLQENPEEAIQRMANN
TLNSYFYYSEDDKKWNICREDENNERVWIQQDEEPKEEMDKMRNELIEKLRKQFIGEENK
DIETLKSNLKDQLQMQNDIEDNNADPKDKEIMKGMTAEQIKKIKRNKKKAKRQAEKKKQK
WYQSRVNTYIYVKGLPLSITEEKLDEFFSRAGVIRKDPITNKKKIKIYSDENGLPKGDAV
ISFQMMESVEIAITMLDEREIEPGHIIRVERANFEQHGDTYKKREGVVINKEKALDKIQL
AQMKAAQRQALGWEDEDQIDTGLKIVILKNVFTLKDIEEDPNFLEELREEMAKEIESTCG
PIQRLKIFEENPEGVIEIKFKNSADAKVCIQKMDGRYFDERELECFFWDGKVDYKRSQKQ
MEDDEQRLEEFGKWIEGGDNNNSENGQKQIS


>TTHERM_00683070(gene)
TTATATTGTATATCAAATAAATAAAGATACATTAAATAAAAAAAAATATTTATATAGTAA
ATTCAGTTAATATTAAGTTAATAAAGTTTTATGGAGGAATTTATTTGGTATTATGCAGAT
AGTTAAGCTCTGTAAGAGAGAACACCTATAGGACCTGTTAGCATTAGAGATTTAGATGTT
TTGTATAGGACTTCAGCAATAAATTCTGCAACTTATGTTTGGAAAGAAGGTATGCCTGAA
TGGGTTTAACTTTTTAAAGTATAGGAATTGAAGGAGGCTATTCTAGACGAGCAATAAGAT
ATTAAGGTAATATAAGAACTTTATGAAAAGTAGTAGCAGGAACTAGCTCTAGCTAATTAA
AAGGGTAAAAAGTAATAGAAAATACAAGATAAACTTGACAAAAAATAAGCTTAGATTGAT
CAAAAGTTGCTTGAGGAAGCTAAATATAATTAATCAATGAATAGTGGCAAGGAGGAAGAT
ATAAGTCAAGATTAGGTAAAATAAAACTTGGAATTGTTATAGCAAATAGATGAAGAAGAA
GTGTTAGATGAAGATGAAGAAGAAGAAAGGGAGTATTTAAAGCTGTTATAAGAAAATCCA
GAAGAAGCGATTTAAAGAATGGCCAATAACACTTTAAACAGCTATTTTTACTATTCTGAA
GATGATAAAAAGTGGAATATTTGTAGAGAAGATGAAAATAATGAGAGAGTTTGGATCTAA
TAAGATGAAGAACCTAAAGAAGAAATGGATAAAATGAGAAATGAATTGATAGAAAAGCTT
AGAAAATAATTTATAGGTGAAGAAAACAAAGATATTGAGACATTGAAAAGCAATTTGAAA
GATCAGCTATAAATGTAAAATGATATTGAAGATAATAACGCTGATCCTAAAGATAAAGAA
ATTATGAAAGGTATGACAGCAGAGCAAATTAAAAAGATAAAACGTAACAAAAAGAAAGCC
AAAAGATAAGCTGAAAAAAAGAAATAGAAATGGTATTAATCTAGGGTTAATACATATATA
TATGTAAAGGGATTGCCTCTTTCTATTACAGAAGAAAAACTCGATGAATTCTTTTCCAGA
GCAGGAGTAATTAGAAAGGACCCAATCACCAATAAAAAAAAGATCAAAATTTACTCGGTA
ATTAATTTAAGGGGTATTATGTAAGTAATATCATAATAATAATAAGTTTATAAAACAAAA
TACTTCCTTTTAAAAGCAATTAATTTATTTCTTAAATAACTAATCTTACTTTTAAGTAGA
ATGATTCTACACCATCAAAGAGTTGTTGCATTTTACCTTACTTCAAAAAATTACAACATT
TATTAGCAACTTATTTTTATTAAGATGTTAAAATTAGTTTAATATTTGAGATTAATTGCT
GTTATTATTATTTTATGACATTTAAATATTTATTATTTATTTTATAATTAGGATGAAAAC
GGTCTCCCTAAAGGTGATGCAGTTATCAGCTTTTAGATGATGGAATCTGTAGAAATTGCA
ATTACTATGCTTGATGAGAGAGAAATAGAACCAGGCCATATTATTAGGGTCGAAAGAGCT
AATTTTGAATAGCATGGAGATACTTATAAGAAAAGAGAAGGTGTTGTTATTAACAAAGAA
AAAGCTTTGGATAAAATTTAACTTGCCTAAATGAAAGCTGCTCAAAGATAGGCTCTGGGT
TGGGAAGATGAAGACCAAATTGACACAGGACTTAAAATTGTCATATTAAAAAATGTATTT
ACTCTTAAGGATATAGAAGAAGATCCAAATTTCTTGGAAGAACTCAGAGAAGAAATGGCT
AAAGAGATAGAGTCAACTTGTGGACCAATTTAGAGATTAAAAATATTTGAAGAAAATCCA
GAAGGAGTTATTGAAATTAAATTTAAAAATTCTGCTGATGCCAAGGTTTGCATTCAAAAA
ATGGATGGTAGATATTTTGATGAGAGAGAACTTGAGTGCTTTTTCTGGGATGGTAAGGTA
GATTACAAAAGGTCTTAAAAACAAATGGAAGATGACGAATAAAGACTTGAAGAATTTGGT
AAATGGATAGAAGGAGGTGATAATAATAATTCAGAAAATGGTTAAAAATAAATTAGTTGA