Identifiers and Description

Gene Model Identifier

TTHERM_00658770

Standard Name

RRM42 (RNA recognition motif-containing protein 42)

Aliases

PreTt02162 | 97.m00148 | 3724.m00055

Description

RRM42 polypyrimidine tract-binding protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF04394 ) Protein of unknown function, DUF536
  • ( TIGR01659 ) sex-lethal family splicing factor
  • ( TIGR01649 ) hnRNP-L/PTB/hephaestus splicing factor family
  • ( PF00076 ) RNA recognition motif. (a.k.a. RRM,

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.3%

TetraMine Data

TTHERM_00658770

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_16215.19.997093137033517e-262polypyrimidine tract binding p
rotein (1174 aa)
WormBaseWBGene000042070.000000009996807949091551locus:ptb-1 status:Confirmed
UniProt:Q18999 protein_id
:CAA85411.3
DictyBaseDDB_G02749950.000009999254677478949DDB_G0274995 on chromosome: 2
position 4844842 to 4848156

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00658770(coding)
ATGAATCCATCAAATGACACTACCAAAGGGTAACCATTTTACATAGAAAAAGAAGATTAA
GAGCAGGGGAAAATCTAAAATACCAATTAAATGATCAATTAAGAGTAAAATCATACTAAC
TTAAACAATAATTTGGATGAAAATTGTGAGTCACCAAGCGATACTACTCATAGTAACTCG
AACATAGTAAATGAAAAATAAAATCTTTAAGCTTATCTTATGTTTGACTCGGGAAATTCA
TCTCAACCTCAAAATGAGTGCTCTAAGGAAATAGATGGTTTGATTGCCTCTGAAAAAAAG
GAAAAAAGTTTAAGTCAAGAAATTGAAAATAAGCAGCAAACTTAGTCTTAAACAGATCTT
TAAATAATAAAAAAGTAGGAATAGCAACAAGACTCTAGTTCTTAATCTGATTATTAGTAT
TTATATTATGTAAGTAGCAATAATAATGGCAATAGCAACAATGATAGCAGCAAAAACTAA
ATGAATAATGATAACAATTCTGGCGGCAATAACAATACCAACAAACATTTTGGAATCAGT
AATAATAATATTAGCCCTTAGAATGATTCAAGTTCTAAGATTGATTAATTGTCAAAAGGG
ATTAGACCTTCTAAAGTTCTTTTAGTTATGGTATAAAATCCACAGGATGAAGTCATAGAA
CATAGAATTATTTTTGAAAAGTTTTCATTTTTTGGAGAGGTAGAATAGATTCTTATATTT
AGTAAGAAGCAACCATGGAAATTGTTTGTGGATATGAATTCAATAGAAGTTGCTATAAAG
GCTAAAAATGCGCTTGAAAACTCTTCAATATGTGTCAATAATTTAGAACTTAAAATGAAG
GTTTAATTTTCGAGCCAATAAAATCTTGTTCTTAAGAATGGTAATGGAGGAATAAACTAT
AAAGATTTAAACAAGAAATTTGAGAAAACTTAGCTCTCTTACAGCATTAAAATTGATCCA
ACCTCTTCATAAAGCTAAAACTTATATTAATCAGCTCAAATTATGGATATGAACAGGCGC
CATATTGCATCTTAATTTGTTTCTGCGCAGAGTATGTAGTTACCAAATCCCTAGTTACAA
ATGCTTAAAGTTACTGACCCTTCAGCTGTTTAGTCTATGACCTTTTAAGTTGGGGTTCCT
CCATAAAAGGTCTAAATAATGAGTAGTAGCTTGATATAATAAGATCAAAATTAATACATA
CCTTAGTAAATGGCCCCAATAGTAGTTACTAACTCTGGAATGCAAACTATTTAGCCTTAA
GTTCCTATCTATTAAACAGGTAGAGATTCTCCACAAATGATGCAAAATTCAGGTTTAGCT
CATCCAAAAATCAATATGACAGGATCAGTTTAAATGTAATCGGGAAATTTAATTTAAATG
GCACCTTATAATTAATACGAGTAGCTTTAATAACCTTTAATGACTTATAGCTTTGGTGGA
AACCCTGTAATTCTTAAGGATGATTCTTTTTCAAATTAATAGGTTCAGCAGAATTAGAAT
TAGTTATTCTAATCTTAACATTATATTGGCTAGCATTTAAATAATTAGTATTAACAACCT
AAGTCTGAAATGACTAGCAGTTTGCAATATCCCATTAATTAAATATCTAGCTATCACTAA
ACAATAAATATGACTTAATCTATGAATATTCATAGCAATAGTATGACTTTCAGTAAACCC
TAAGAATCTATTTTTGCATTAAATAAAAATGATAATAACCCAAAAAATGAATCAGTAGAA
CAACTTGATGATATCTTAGAAAGAATCCAAAATAATCAGTTTGAAAACTCTGGCGAAATT
TCTAAAGAAGACCTTAAAGACTTAGAAGAGCAAAAATCAAATTCATTTGACGATTTTAAA
GGATTTAATGATCAAAAGACAAGTATTGGTTAAGAAAATTTATAAAATAATCAACAATTG
TTAAATAGCTCTGACAATAGGAATGGCATTAACTAATCTCCCTTTAGTCCTGAGTAAAAA
AGTATTTAACCATAATCCACCATGCAAAGATCTCATAGCAATAGTTCAGATGGGAATTAA
ATGACTGGCATCTAAAAATTAGATTAACTTATTGGATAGGCGTAAGGTTCAGATTAATCT
GATGGTGAATAATACCCACTATCAGACGATGAAGGACCTACTTTTCCTTTCTAAAAAACT
TAATAAAAATCTTAGCAATAATAACCTATTAGAGCAATATAGTAACTGGATACTCAGCTA
AAAACATAATATGGTAGTAATAATTAAGGAGCTTACTTTATAAATATGTAAGGCAGTGCA
GGATAGTAGAATTAAAGCGCAAATATTATTGGAAATTAATTAATGAGCTCATCTTAAGGC
AAGCCTATTCATGGTAGCTTAATGATGTAGCCATATATTTAAAATAATTAATTAAATTAA
AATTAATCTCTCATGAACCAAGGATAAGTATAAATGCTACAGCAGTAAGCTAATTCTGGA
GTTTAATTTGGTCAATTTTAAAACTAAAATGCTAATAACTCGTATTAGTAAATACCAAAT
TAGTATGGATACAATATGAGATAAAATAGGTAAAGAATGCAATAAAATAGTAACCCAGCT
TATGCCTAATCATGCATGTTAGTTAATTAGCAGTAATAATAAAATTTATAATTATAACAA
TCTGGTTAGGTTAATTTACAATAATTTGATGGCTAAAATATTTCGTATAGCATGTAAATT
AAACCAAATTTCCATAGTATGAGTACAAATATTTCAGGTATGAGAATGGAAGAAAATATG
GGAACTTTCAATGGGTCTACCTACATAAAGTAAGGATTTTTGGAAGACAGCAAACCTTCT
TTAGTCATTTATGTTAACCATTTAATGAATAAAGATATTACTGTTACTCACCTCTACAAT
ATCTTTAGCAATTTTGGTGACATAGTTAAAATTATATTGAAAAGAAATAAATGTACAGCT
TTCATTGAGTATACGATGTAAGAGAACGCTACAAAAGCAAAGGAATTTATGGATAAAAAA
ATCTTCTTTGATAATGAGATCAGAGTATTCTATTCTCACTTTGAAACTCTCTAAAAATAA
GATGACAAATTCCAAGAATAATTTATAGGAAGCGAATAAACTAACCGTTTCTAAAAAGAT
AGCAAAATGACTTTAAACCCTCCTTCTCTAGTTCTTCATATTTCAAGTCTCAAATAAGAA
ATTTGTGATCACGAGAAAATACATGAATTGTTCCGTCCTTATGGCAAAATTGAAGCAATC
CATATTGAAAAAGTTCCTCCTAGATACATGAGCCATATAAAATTTTCTTCGTTGAAGGAG
TCTTTAATGGCTATAGCTCATATGCACAACAAAGAAATCAAAGGAAGAAAGATGCTTATT
TCATTTACTAGAAAAAAACTAGACACAACAACTAAAAATGTAGTAACTTACTCTAAAAAT
ATTCAATTCAACAATTGA


>TTHERM_00658770(protein)
MNPSNDTTKGQPFYIEKEDQEQGKIQNTNQMINQEQNHTNLNNNLDENCESPSDTTHSNS
NIVNEKQNLQAYLMFDSGNSSQPQNECSKEIDGLIASEKKEKSLSQEIENKQQTQSQTDL
QIIKKQEQQQDSSSQSDYQYLYYVSSNNNGNSNNDSSKNQMNNDNNSGGNNNTNKHFGIS
NNNISPQNDSSSKIDQLSKGIRPSKVLLVMVQNPQDEVIEHRIIFEKFSFFGEVEQILIF
SKKQPWKLFVDMNSIEVAIKAKNALENSSICVNNLELKMKVQFSSQQNLVLKNGNGGINY
KDLNKKFEKTQLSYSIKIDPTSSQSQNLYQSAQIMDMNRRHIASQFVSAQSMQLPNPQLQ
MLKVTDPSAVQSMTFQVGVPPQKVQIMSSSLIQQDQNQYIPQQMAPIVVTNSGMQTIQPQ
VPIYQTGRDSPQMMQNSGLAHPKINMTGSVQMQSGNLIQMAPYNQYEQLQQPLMTYSFGG
NPVILKDDSFSNQQVQQNQNQLFQSQHYIGQHLNNQYQQPKSEMTSSLQYPINQISSYHQ
TINMTQSMNIHSNSMTFSKPQESIFALNKNDNNPKNESVEQLDDILERIQNNQFENSGEI
SKEDLKDLEEQKSNSFDDFKGFNDQKTSIGQENLQNNQQLLNSSDNRNGINQSPFSPEQK
SIQPQSTMQRSHSNSSDGNQMTGIQKLDQLIGQAQGSDQSDGEQYPLSDDEGPTFPFQKT
QQKSQQQQPIRAIQQLDTQLKTQYGSNNQGAYFINMQGSAGQQNQSANIIGNQLMSSSQG
KPIHGSLMMQPYIQNNQLNQNQSLMNQGQVQMLQQQANSGVQFGQFQNQNANNSYQQIPN
QYGYNMRQNRQRMQQNSNPAYAQSCMLVNQQQQQNLQLQQSGQVNLQQFDGQNISYSMQI
KPNFHSMSTNISGMRMEENMGTFNGSTYIKQGFLEDSKPSLVIYVNHLMNKDITVTHLYN
IFSNFGDIVKIILKRNKCTAFIEYTMQENATKAKEFMDKKIFFDNEIRVFYSHFETLQKQ
DDKFQEQFIGSEQTNRFQKDSKMTLNPPSLVLHISSLKQEICDHEKIHELFRPYGKIEAI
HIEKVPPRYMSHIKFSSLKESLMAIAHMHNKEIKGRKMLISFTRKKLDTTTKNVVTYSKN
IQFNN


>TTHERM_00658770(gene)
ATGAATCCATCAAATGACACTACCAAAGGGTAACCATTTTACATAGAAAAAGAAGATTAA
GAGCAGGGGAAAATCTAAAATACCAATTAAATGATCAATTAAGAGTAAAATCATACTAAC
TTAAACAATAATTTGGATGAAAATTGTGAGTCACCAAGCGATACTACTCATAGTAACTCG
AACATAGTAAATGGTAATTTTAATTATTCGTCTTCTTCATCATCGTGCTCATATAAAAAT
CAAAATCAAGAAAAATAAAATCTTTAAGCTTATCTTATGTTTGACTCGGGAAATTCATCT
CAACCTCAAAATGAGTGCTCTAAGGAAATAGATGGTTTGATTGCCTCTGAAAAAAAGGAA
AAAAGTTTAAGTCAAGAAATTGAAAATAAGCAGCAAACTTAGTCTTAAACAGATCTTTAA
ATAATAAAAAAGTAGGAATAGCAACAAGACTCTAGTTCTTAATCTGATTATTAGTATTTA
TATTATGTAAGTAGCAATAATAATGGCAATAGCAACAATGATAGCAGCAAAAACTAAATG
AATAATGATAACAATTCTGGCGGCAATAACAATACCAACAAACATTTTGGAATCAGTAAT
AATAATATTAGCCCTTAGAATGATTCAAGTTCTAAGATTGATTAATTGTCAAAAGGGATT
AGACCTTCTAAAGTTCTTTTAGTTATGGTATAAAATCCACAGGATGAAGTCATAGAACAT
AGAATTATTTTTGAAAAGTTTTCATTTTTTGGAGAGGTAGAATAGATTCTTATATTTAGT
AAGAAGCAACCATGGAAATTGTTTGTGGATATGAATTCAATAGAAGTTGCTATAAAGGCT
AAAAATGCGCTTGAAAACTCTTCAATATGTGTCAATAATTTAGAACTTAAAATGAAGGTT
TAATTTTCGAGCCAATAAAATCTTGTTCTTAAGAATGGTAATGGAGGAATAAACTATAAA
GATTTAAACAAGAAATTTGAGAAAACTTAGCTCTCTTACAGCATTAAAATTGATCCAACC
TCTTCATAAAGCTAAAACTTATATTAATCAGCTCAAATTATGGATATGAACAGGCGCCAT
ATTGCATCTTAATTTGTTTCTGCGCAGAGTATGTAGTTACCAAATCCCTAGTTACAAATG
CTTAAAGTTACTGACCCTTCAGCTGTTTAGTCTATGACCTTTTAAGTTGGGGTTCCTCCA
TAAAAGGTCTAAATAATGAGTAGTAGCTTGATATAATAAGATCAAAATTAATACATACCT
TAGTAAATGGCCCCAATAGTAGTTACTAACTCTGGAATGCAAACTATTTAGCCTTAAGTT
CCTATCTATTAAACAGGTAGAGATTCTCCACAAATGATGCAAAATTCAGGTTTAGCTCAT
CCAAAGTAGTAGAATTATTTATAAAATTATTTGATTTTTAATAATTTAAACTAAAAATAG
ATTTTTATATTATTTTATTTCAAGGTAAGTTTGATAAATTTAAAGTATTTCTTTCTTACC
TCAAAATATTTCAGTTTTTTTATAAAATAAAATTAAATTAAAAATACAAAAAAATAAAAA
ATTAAATTATCAAATCATATCTTAAGCAAGGTTTGTAATTTTAACTGCATAGGATGAGAT
AGATAGAATTCAATATTTTCTTCTTTATCATATAAATATGATCTGTTTATTTATCTTTCT
TAAGCTCAAGGCAGGCAATATATATATTCTTAAATACCATCAATAGAAGTTTTCTTATTT
ATTAATAATAAATAGTTAAAACTTTATTAAACTTATTTAAATCAAACAAACTTGCATTTT
AAAATAACTTATAAAAATATGATTAAAAAATTACTATTTTAATTAAATTGATTTTTTAAT
TTATTTATAAACAGAATCAATATGACAGGATCAGTTTAAATGTAATCGGGAAATTTAATT
TAAATGGCACCTTATAATTAATACGAGTAGCTTTAATAACCTTTAATGACTTATAGCTTT
GGTGGAAACCCTGTAATTCTTAAGGATGATTCTTTTTCAAATTAATAGGTTCAGCAGAAT
TAGAATTAGTTATTCTAATCTTAACATTATATTGGCTAGCATTTAAATAATTAGTATTAA
CAACCTAAGTCTGAAATGACTAGCAGTTTGCAATATCCCATTAATTAAATATCTAGCTAT
CACTAAACAATAAATATGACTTAATCTATGAATATTCATAGCAATAGTATGACTTTCAGT
AAACCCTAAGAATCTATTTTTGCATTAAATAAAAATGATAATAACCCAAAAAATGAATCA
GTAGAACAACTTGATGATATCTTAGAAAGAATCCAAAATAATCAGTTTGAAAACTCTGGC
GAAATTTCTAAAGAAGACCTTAAAGACTTAGAAGAGCAAAAATCAAATTCATTTGACGAT
TTTAAAGGATTTAATGATCAAAAGACAAGTATTGGTTAAGAAAATTTATAAAATAATCAA
CAATTGTTAAATAGCTCTGACAATAGGAATGGCATTAACTAATCTCCCTTTAGTCCTGAG
TAAAAAAGTATTTAACCATAATCCACCATGCAAAGATCTCATAGCAATAGTTCAGATGGG
AATTAAATGACTGGCATCTAAAAATTAGATTAACTTATTGGATAGGCGTAAGGTTCAGAT
TAATCTGATGGTGAATAATACCCACTATCAGACGATGAAGGACCTACTTTTCCTTTCTAA
AAAACTTAATAAAAATCTTAGCAATAATAACCTATTAGAGCAATATAGTAACTGGATACT
CAGCTAAAAACATAATATGGTAGTAATAATTAAGGAGCTTACTTTATAAATATGTAAGGC
AGTGCAGGATAGTAGAATTAAAGCGCAAATATTATTGGAAATTAATTAATGAGCTCATCT
TAAGGCAAGCCTATTCATGGTAGCTTAATGATGTAGCCATATATTTAAAATAATTAATTA
AATTAAAATTAATCTCTCATGAACCAAGGATAAGTATAAATGCTACAGCAGTAAGCTAAT
TCTGGAGTTTAATTTGGTCAATTTTAAAACTAAAATGCTAATAACTCGTATTAGTAAATA
CCAAATTAGTATGGATACAATATGAGATAAAATAGGTAAAGAATGCAATAAAATAGTAAC
CCAGCTTATGCCTAATCATGCATGTTAGTTAATTAGCAGTAATAATAAAATTTATAATTA
TAACAATCTGGTTAGGTTAATTTACAATAATTTGATGGCTAAAATATTTCGTATAGCATG
TAAATTAAACCAAATTTCCATAGTATGAGTACAAATATTTCAGGTATGAGAATGGAAGAA
AATATGGGAACTTTCAATGGGTCTACCTACATAAAGTAAGGATTTTTGGAAGACAGCAAA
CCTTCTTTAGTCATTTATGTTAACCATTTAATGAATAAAGATATTACTGTTACTCACCTC
TACAATATCTTTAGCAATTTTGGTGACATAGTTAAAATTATATTGAAAAGAAATAAATGT
ACAGCTTTCATTGAGTATACGATGTAAGAGAACGCTACAAAAGCAAAGGAATTTATGGAT
AAAAAAATCTTCTTTGATAATGAGATCAGAGTATTCTATTCTCACTTTGAAACTCTCTAA
AAATAAGATGACAAATTCCAAGAATAATTTATAGGAAGCGAATAAACTAACCGTTTCTAA
AAAGATAGCAAAATGACTTTAAACCCTCCTTCTCTAGTTCTTCATATTTCAAGTCTCAAA
TAAGAAATTTGTGATCACGAGAAAATACATGAATTGTTCCGTCCTTATGGCAAAATTGAA
GCAATCCATATTGAAAAAGTTCCTCCTAGATACATGAGCCATATAAAATTTTCTTCGTTG
AAGGAGTCTTTAATGGCTATAGCTCATATGCACAACAAAGAAATCAAAGGAAGAAAGATG
CTTATTTCATTTACTAGAAAAAAACTAGACACAACAACTAAAAATGTAGTAACTTACTCT
AAAAATATTCAATTCAACAATTGA